KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2096Help
Entry
CMS_2096          CDS       T00678                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CMS_2096
Enzymes [BR:cms01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     CMS_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2223994..2224917
Genome map
AA seq 307 aa AA seqDB search
MDERIRLWTDPTPVHPVPRLAEALGLHPERLLMKRDDLIGWGGGGNKARKLEHSLGRAVA
RGATTVVTTGAAQSNHARMTAAAGASLGLDVVLVLEGHEVAARGNVLLDGLFGARIEWSG
DEGAESRAASVVAELEGAGTRVHRVAFGGSDAHSVQGFVDAGHELTAQVGAVDHVVVALG
SGGTMAGLVEALGPERVLGVHCGAVAEPRAVVAGFLTERGTGIEAAALRIDADRVGPGYA
HLTDEAREALVLVARTTGILLDPTYTARAAAGLAAAVGDGSIGADDRVVLWHSGGVPGLF
GHADLGA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggacgaacgcatccgcctctggaccgaccccacccccgtgcacccggtcccccgcctc
gcggaggcgctcggcctgcaccccgagcggctcctgatgaagcgcgacgacctcatcggc
tggggcggcggcgggaacaaggccaggaagctcgagcactcgctcggccgggccgtcgcg
cgcggggccaccaccgtggtcaccacaggggctgcgcagagcaaccacgcgcggatgacg
gcggcggcgggcgcgtccctcggcctcgacgtcgtcctggtgctcgagggccacgaggtc
gccgcgcgcggcaacgtgctgctcgacgggctgttcggcgcgcgcatcgagtggtcgggc
gacgagggcgcggagtcgcgcgccgcgtccgtcgtggccgagctggagggtgcgggcacg
cgcgtgcaccgcgtggcgttcggcggatccgacgcgcactccgtgcagggcttcgtcgac
gcggggcacgagctcacggcgcaggtcggtgcggtcgaccacgtggtcgtcgccctcggc
tccggcggcacgatggccgggctcgtcgaggcgctcggccccgagcgcgtcctcggcgtg
cactgcggcgccgtcgccgagccgcgcgccgtggtggcggggttcctgacggagcgcggg
acggggatcgaggcggctgccttgcgcatcgacgcggaccgggtcggccccggctacgcc
cacctcaccgacgaggcccgggaagcgctcgtgctcgtggcgaggacgacggggatcctc
ctcgaccccacctacacggcccgcgcggcggcggggctggcggccgcggtgggcgacggg
tccatcggagcggacgaccgcgtcgtcctctggcactcgggcggcgtcccggggctcttc
ggccacgccgacctcggcgcctga

DBGET integrated database retrieval system