KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2381Help
Entry
CMS_2381          CDS       T00678                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMS_2381 (tpiA)
   01230 Biosynthesis of amino acids
    CMS_2381 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMS_2381 (tpiA)
   00051 Fructose and mannose metabolism
    CMS_2381 (tpiA)
   00562 Inositol phosphate metabolism
    CMS_2381 (tpiA)
Enzymes [BR:cms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CMS_2381 (tpiA)
Exosome [BR:cms04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CMS_2381 (tpiA)
  Exosomal proteins of bladder cancer cells
   CMS_2381 (tpiA)
  Exosomal proteins of melanoma cells
   CMS_2381 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2525055..2525834)
Genome map
AA seq 259 aa AA seqDB search
MIGVSLKMYLGHAETLAWCEAVAAIARTHPATTRGEAELVVLPSYLSVPAAVGILDGVAA
VGAQDLAADDAGASTGEVSGGQIRELGATFVEVGHAERRRLFGETDEVVRRKADRALASG
LVPLLCVGEEDRRAPADAARECIRQLDDALALAAGRGHGGRIVVAYEPQWAIGAAEPASD
AHIRAVGRELRAHVRSHSAHPGSAVVYGGSAGPGLLTRIGDDVDGLFLGRFAHDPRAVAA
ILDEVHARAAAGPAAGASR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggcgtcagcctgaagatgtacctcgggcacgccgagacgctcgcgtggtgcgag
gccgtcgcggccatcgcgcgcacgcacccggcgacgacgcgcggcgaggccgagctcgtg
gtgctgccgtcgtacctgtcggtgccggccgctgtcggcatcctcgacggggtcgccgcc
gtgggcgcgcaggatctcgcggccgacgacgccggcgcatccacgggcgaggtgtccggc
gggcagatccgggagctcggcgcgacgttcgtcgaggtcggccacgccgagcggcgacgg
ctcttcggcgagacggacgaggtcgtgcggcggaaggccgaccgggccctggcgtccggt
ctggtgcccctcctctgcgtcggcgaggaggaccggcgggctcccgccgacgcggcccgg
gagtgcatccgccagctcgacgacgcgctcgccctggccgctggtcgcgggcacggcggc
cggatcgtggtcgcctacgagccgcagtgggcgatcggcgccgccgagcccgcctccgac
gcgcacatccgcgcggtcggccgggagctgcgcgcgcacgtacggtcccactccgcgcac
ccaggatccgcggtcgtctacggcggcagcgccggccccggcctcctcacccgcatcggc
gacgacgtggacggcctcttcctcggccgcttcgcgcacgacccccgcgcggtcgcggcg
atcctcgacgaggtgcacgcgcgcgcggcggccggtccggcggccggcgcctcccgctga

DBGET integrated database retrieval system