KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2675Help
Entry
CMS_2675          CDS       T00678                                 

Gene name
bga
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CMS_2675 (bga)
Enzymes [BR:cms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CMS_2675 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2823016..2824863
Genome map
AA seq 615 aa AA seqDB search
MSRTSPLPCPALTQGHDMPGLPASSARFRIGADDFELDGRPHRVIAGALHYFRVHPDQWA
DRIRKARLMGLDTIETYVAWNAHSPERGTFDTSAGLDLGRFLDLVHAEGMHAIVRPGPYI
CAEWDGGGLPGWLFGDPAVGVRRSEPLYLAAVDEFLRRVYEIVAPRQIDMGGPVILVQIE
NEYGAYGDDAEYLRHLVDLTRESGIIVPLTTVDQPTDEMLSRGSLDELHRTGSFGSRAAE
RLETLRRHQRTGPLMCSEFWDGWFDHWGEHHHTTSAADAAAELDALLAAGASVNIYMFHG
GTNFGFTNGANHKGTYQSHVTSYDYDAPLDETGSPTEKYFAFRDVIARYRSVPDEVPTRR
GDAPAFKVAFDAAVPLADLVADADAWRATDAVPSMDALGVFRGFALHRVELPASDRTRVL
AFGEVRDRAVVSVDGVRVGVIQRDQHETAIAVPPGRILEVLVEDQGRVNYGVRIGEAKGL
IGPATLDGRELTGWESLPLDLGAMAASVSSAASFAASSVAEPVRFLDGPVLAHATFDVDA
PADLFLDTRSWGKGVAFVNGFALGRYWTRGPQHTLYVPGAQLRAGRNDLVVFETGAAADP
VVAFLAQPELGHLES
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgcacctcccctctcccatgccccgccctcacgcaaggacacgacatgcccggc
ctccccgcatccagcgcccgcttccgcatcggcgccgacgacttcgagctcgacggccgc
ccgcaccgcgtcatcgcgggcgcgctccactacttccgcgtgcaccccgaccagtgggcc
gaccggatccgcaaggcccgcctcatgggactcgacaccatagagacgtacgtcgcctgg
aacgcgcactcccccgagcgcggcaccttcgacacgagcgccggcctcgacctcggccgc
ttcctcgacctcgtgcacgccgagggcatgcacgcgatcgtgcgccccggcccctacatc
tgcgcggagtgggacggcggcgggctgcccggctggctgttcggggatcccgcggtgggg
gtccgccgcagcgagccgctgtacctcgcggcggtcgacgagttcctccgccgcgtgtac
gagatcgtcgcgccgcggcagatcgacatgggcgggcccgtgatcctcgtgcagatcgag
aacgagtacggcgcgtacggcgacgacgccgagtacctccgccacctcgtcgacctcacg
cgcgagtcgggcatcatcgtgccgctcacgaccgtcgaccagccgaccgacgagatgctc
tcccgcggcagcctcgacgagctgcaccgcaccggatccttcggctcgcgcgccgccgag
cgcctcgagaccctgcgccgccaccagagaaccggcccgctcatgtgcagcgagttctgg
gacggctggttcgaccactggggcgagcaccaccacacgacctcggccgccgacgccgcc
gccgagctggatgcgctgctcgccgcgggcgcgtccgtgaacatctacatgttccacggc
ggcacgaacttcggcttcacgaacggcgccaaccacaagggcacgtaccagtcgcacgtc
acctcgtacgactacgacgccccgctggacgagaccggatcccccacggagaagtacttc
gcgttccgcgacgtgatcgcgcgctaccggtcggtgcccgacgaggtgcccacgcgccgc
ggcgacgcgcccgccttcaaggtggcgttcgacgcggccgtgccgctggccgacctggtc
gcggacgccgacgcctggcgcgcgaccgacgccgtgccgtcgatggatgcgctcggcgtc
ttccgcgggttcgcgctgcaccgcgtggagctgcccgcatccgaccgcacgcgcgtgctg
gcattcggcgaggtgcgcgaccgcgccgtcgtgtcggtggacggggtgcgggtcggcgtg
atccagcgcgaccagcacgagaccgcgatcgcggtgccgcccggccggatcctcgaggtg
ctcgtggaggaccaggggcgcgtgaactacggcgtgcggatcggcgaggcgaagggcctc
atcggaccggcgacgctcgacggccgagagctcaccgggtgggagagcctgccgctcgac
ctcggggcgatggcggcgtcggtgtcctcggcggcgtccttcgccgcgtcctccgtcgcg
gagccggtccgcttcctcgatggcccggtgctcgcgcacgcgaccttcgacgtggacgcg
cccgccgacctcttcctcgacacgcgctcgtggggcaagggagtcgcgttcgtcaacggg
ttcgcgctcggccgctactggacccgcggcccgcagcacacgctctacgtgccgggcgcc
cagctccgcgcgggccggaacgacctcgtcgtgttcgagacgggcgcggcggcggatccg
gtcgtggcgttcctggcgcagccggagctggggcacctggagtcgtag

DBGET integrated database retrieval system