KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2739Help
Entry
CMS_2739          CDS       T00678                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMS_2739 (gpmA)
   01230 Biosynthesis of amino acids
    CMS_2739 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMS_2739 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CMS_2739 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMS_2739 (gpmA)
Enzymes [BR:cms01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CMS_2739 (gpmA)
Exosome [BR:cms04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CMS_2739 (gpmA)
  Exosomal proteins of melanoma cells
   CMS_2739 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2884120..2884875
Genome map
AA seq 251 aa AA seqDB search
MAEPRTLVLLRHGNSDWNQKNLFTGWVDVELSEQGVAEGQRAGELLAESGILPDVLHTSV
LIRAIDTANIALKRAGRSWIPVQRTWRLNERHYGALQGKDKAQTLAEYGPEQFATWRRSF
DVPPPPIADDDEYSQSADPRYADLGDTLPRTECLKDVIERMLPYWESDIQPDLASGRTVL
VTAHGNSLRALVKHLDGISDADIAELNIPTGIPLVYRLDEDFRPIVPGGEYLDPEAAAAG
AAAVAAQGSKK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccccgcaccctcgtgctgttgcgtcacggcaacagcgactggaaccagaag
aacctgttcaccggatgggtggacgtcgagctgagcgagcagggtgtcgcggaggggcag
cgcgccggcgagctcctcgccgagtccggcatcctccccgacgtactgcacacctccgtc
ctcatccgcgccatcgacaccgccaacatcgcgctcaagcgcgccggccgctcgtggatc
cccgtccagcgcacctggcgcctcaacgagcgccactacggcgcgctgcagggcaaggac
aaggcccagaccctcgccgagtacggccccgagcagttcgccacctggcgccgctcgttc
gacgtgccgccgccccccatcgccgacgacgacgagtactcgcagtcggccgacccccgc
tacgccgacctcggcgacacgctgccccgcaccgagtgtctcaaggacgtcatcgagcgg
atgctgccgtactgggagtccgacatccagcccgacctcgcctccggccgcaccgtgctc
gtcacggcgcacggcaactcgctgcgtgcgctcgtcaagcacctcgacgggatctccgac
gcggacatcgcggagctcaacatcccgaccggcatcccgctcgtctaccgcctcgacgag
gacttccgcccgatcgtccccggcggcgagtacctcgacccggaggccgccgccgcaggc
gctgcggccgtggccgcgcagggctccaagaagtag

DBGET integrated database retrieval system