KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2832Help
Entry
CMS_2832          CDS       T00678                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMS_2832 (pfkA)
   01230 Biosynthesis of amino acids
    CMS_2832 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMS_2832 (pfkA)
   00030 Pentose phosphate pathway
    CMS_2832 (pfkA)
   00051 Fructose and mannose metabolism
    CMS_2832 (pfkA)
   00052 Galactose metabolism
    CMS_2832 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CMS_2832 (pfkA)
Enzymes [BR:cms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CMS_2832 (pfkA)
Protein phosphatases and associated proteins [BR:cms01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CMS_2832 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2986042..2987085
Genome map
AA seq 347 aa AA seqDB search
MPHDGRVRIGILTSGGDCPGLNAVIRGAVLKGTTIHKQEFVGFRDGWRGVVDGDVMPLAR
RDIQGIGKQGGTILGTSRTNPFEGDGGVERIQENLDRLGIDAILAIGGEGTLAAAKRLTD
AGLKIVGVPKTVDNDLDATDYTFGFDTAVQIATDAMDRLRTTGDSHSRCMVAEVMGRHVG
WIALHSGMAAGAHAILIPEQKTSMDEIIGWVRSAYDRGRAPLVVVAEGFIPEHASDAHGE
RGLDAFGRPRLGGIGEQIAPIIEERTGIETRATTLGHIQRGGTPSSYDRVLATRLGLAAV
DSVRDGHWGRMVALRGTDIVHVGFEEALRRLKTVPQHRYDEAAILFG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgccccatgatggacgtgtgcgcataggaatcctcacctcaggcggagactgccccgga
ctcaacgcggtcatccgcggggcggtgctcaagggaacgaccatccacaagcaggagttc
gtcggcttccgcgacggctggcggggcgtcgtcgacggcgacgtcatgccgctcgcgcgc
cgcgacatccagggcatcggcaagcagggcggcacgatcctcggcaccagccgcacgaac
ccgttcgagggcgacggcggcgtggagcggatccaggagaacctcgaccgcctcggcatc
gacgcgatcctcgccatcggcggcgagggcacgctcgcggccgcgaagcgcctcaccgac
gcgggcctcaagatcgtcggcgtcccgaagacggtcgacaacgacctcgacgcgaccgac
tacacgttcggcttcgacaccgcggtgcagatcgcgaccgacgccatggaccgcctccgc
acgacgggcgactcccacagccgctgcatggtggccgaggtcatgggccgccacgtcggc
tggatcgcgctgcactccggcatggccgcgggcgcgcacgcgatcctcatccccgagcag
aagacgagcatggacgagatcatcggatgggtccgctcggcctacgatcgcgggcgcgcg
ccgctcgtcgtcgtcgcggagggcttcatccccgagcacgcgtccgacgcgcacggcgag
cgcgggctcgacgccttcggccgcccgcggctcggcggcatcggcgagcagatcgcgccc
atcatcgaggagcgcacgggcatcgagacccgcgccacgaccctcggccacatccagcgc
ggcggcaccccgtcgtcgtacgaccgcgtgctcgcgacgcgcctcggcctcgccgcggtc
gacagcgtgcgcgacggccactggggccgcatggtcgcgctccgcggcaccgacatcgtg
cacgtcggcttcgaggaggcgctccgccgcctgaagaccgtgccgcagcaccgctacgac
gaggccgcgatcctcttcggctga

DBGET integrated database retrieval system