KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2840Help
Entry
CMS_2840          CDS       T00678                                 

Definition
uroporphyrin-III c-methyltransferase/uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CMS_2840
Enzymes [BR:cms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CMS_2840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2993763..2994602)
Genome map
AA seq 279 aa AA seqDB search
MTSTDQKPLKGWRVLVPRGGPWGDGVAYDLRAQGATPVVAPMINFAATQDAQALESALAD
LAAGSFDWLTVTSATTVDVLASHRAVVPEGTRIAAVGETTAAALVAAGYTVDFVPSIDSS
ATALLEEWTEMAAGSPRRRVLTLRSEIAKPTLTDGLIARGHDVRSVVAYRTVGVPVSDRI
REDVSSGRVRAILVTSGSVAEQVHEQLGDVPDGVLIACIGPRTAKDARRFGVRVDVVATE
RSAASLIQSLVEIARHEEPRPDTAGLTGLADLLDRSTTE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgacagaccagaagcccctgaagggctggcgcgtgctcgtgcctcgcggcgga
ccgtggggcgacggcgtcgcgtacgatctccgggcgcagggcgcgacgcccgtcgtcgcg
cccatgatcaacttcgccgccacgcaggacgcgcaggcgctcgagtcggccctcgccgac
ctcgccgcgggatccttcgactggctcaccgtcacgagcgccaccacggtggacgtgctc
gcctcgcaccgcgccgtcgtccccgagggcacgcgcatcgcggccgtcggcgagaccacg
gcggccgcgctcgtcgccgcgggatacacggtcgacttcgtgccgtccatcgactcgtcg
gccaccgcgctcctcgaggagtggacggagatggccgccggatccccgcgccgccgcgtg
ctcacgctccgctccgagatcgcgaagcccacgctcaccgacggcctcatcgcgcgcggc
cacgacgtgcgctcggtcgtcgcctaccgcacggtcggcgtccccgtcagcgaccggatc
cgcgaggacgtctcctcgggccgcgtccgcgcgatcctcgtcacctcgggcagcgtcgcg
gagcaggtgcacgagcagctgggcgacgtgcccgacggcgtgctcatcgcctgcatcggc
ccgcgcaccgcgaaggacgcgcgccgattcggcgtgcgcgtcgacgtggtcgccacggag
cgctccgccgcgtcgctcatccagtccctggtcgagatcgcccgccacgaggagccgcga
cccgatacggcggggctcaccggcctcgccgacctcctcgatcggagcaccaccgaatga

DBGET integrated database retrieval system