KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_pCS0061Help
Entry
CMS_pCS0061       CDS       T00678                                 

Definition
cellulase CelA
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CMS_pCS0061
Enzymes [BR:cms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CMS_pCS0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pCS1:43339..45393
Genome map
AA seq 684 aa AA seqDB search
MASPPGWLHTAGGKIVTASGAPYTIRGIAWFGMETSSCAPHGLDTITLAGGMQHIKQLGF
TTVRLPFSNQCLAASGVTGVDADPSLAGLTPLQVMDHVVASAKAAGLDVILDQHRPDSGG
QSELWYTSEYPESRWISDWRMLAKRYASDPTVIGVDLHNEPHGAATWGTGAATTDWRAAA
ERGGNAVLAENPKLLVLVEGIDHQADGTGTWWGGALDSAATASVRLTVANRVVYSPHDYP
STIYGQPWFSASNYPTNLPGIWDAHWGYLAKKDIAPVLVGEFGTKLETASDKQWLNTLVG
YLSSTGISSSFWAFNPDSGDTGGIVKSDWVTPEQAKLDALAPILHPAPGAGPGSSGSGSQ
PGPAKPGAVSVKWQPGGSWASGYVANLDVTATGAVTGWTVSWASPKTTSVVNSWGMRCSV
ASNTVTCTSTDWASKLAAGQTVRVGVQLAGGPAPASPRISVTAAGTPPSQATPPSQATPP
SQATTHGRATHYSLGTGNTIANGNCSMPAVPADRMYVAVSSPEYGGAAACGSHLLVTGPK
GTVRVQIVDQCHECEIGHLDLSEEAFRAIGDFDAGIIPISYTTVRDPSVPAVAVRVKEGS
SRWWAGLQILNAGNRIDRVEVRAGGQWLPLSRTDYGYWVTPSPIPDGPMTVRVTDQYGRS
VVLPGIRMAPGETQSTARRIYQMH
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
gtggcctcgccgcctggatggctgcacacggcgggtgggaagatcgtcaccgcctccggc
gctccgtacacaatccgtggcatcgcgtggtttggcatggagacgtcatcctgcgcgccg
cacggcctggacaccatcaccctcgcgggtggcatgcagcacatcaagcagctgggattc
acgaccgtgcggctgccgttctcgaaccagtgcctcgcggcatctggcgtcacgggtgtc
gatgcggacccatcgcttgccggtctcacaccgctgcaggtcatggatcacgtcgtggct
tcggcgaaggccgccggacttgacgtgatcctcgaccagcaccggccggactcgggcggc
cagtccgagctctggtacacctcggagtaccccgagtcacggtggatctccgactggcgg
atgctcgcgaagcggtacgcctccgaccccacggtcatcggtgtcgatctccacaacgag
ccgcacggggcggcgacgtggggtaccggggcagccacgaccgactggcgggcggcggcc
gagcggggcgggaacgcggtattggccgagaacccgaagctcctcgtgctcgtcgaggga
atcgaccaccaggccgacggaaccggcacctggtggggcggtgcgctggactccgcggcc
actgcatccgtgcgcttgaccgtcgcgaatcgcgtcgtctattccccgcacgactacccc
tcgaccatctacggccagccctggttctccgcatcgaattatccgacgaatcttccggga
atctgggacgcccactggggatacctggcaaagaaggacatcgcccccgtcctcgtgggc
gagttcggtacgaagctcgagacggcgagcgacaagcagtggctcaacaccctcgtcgga
tacctgtcgagcacggggatcagctcatcgttctgggccttcaacccagacagtggcgac
accggcggcattgtgaagtccgattgggtgaccccggagcaggcgaagctcgacgcgctg
gcgccgatcctgcatccggcacccggagcgggtccgggatctagcggatccgggtcgcag
ccaggtccggcgaagccgggcgcggtatcagtgaagtggcagcctggcgggtcctgggca
tccggctacgtggcgaaccttgacgtcaccgcgacaggcgctgtcacgggatggaccgtc
tcatgggccagcccgaaaaccaccagcgtcgtcaacagttggggcatgcgctgtagcgtc
gcctccaacaccgtgacctgcaccagcacggactgggcaagcaagctcgccgccggccag
accgttcgcgtcggcgtgcagttggcgggtggacccgctcccgcttcgcctcgaatcagt
gtcacggcggccggaacgcctccgtcccaagccacgcctccgtcccaggccacgcctccg
tcccaggccacgacgcacggccgtgccacgcactactcgctcggtaccggtaacacgatc
gcgaacggcaactgctccatgccggctgtccccgccgaccgaatgtacgttgcggtcagc
agccccgagtacggcggagccgccgcgtgcgggtcgcacctcctcgtcacgggccccaag
ggcaccgtccgcgtccaaatcgtcgaccaatgccacgaatgcgagatcggacatctcgat
ctgagcgaagaagcgttccgtgccattggcgacttcgatgccggtatcatcccaatcagc
tacaccaccgtccgggatccgtccgtgcccgccgtcgccgtccgggtcaaggagggctca
tcccgatggtgggcaggtctgcagattctgaacgccggcaaccgcatcgaccgtgttgaa
gtccgagccggtgggcagtggctgcccctgagtcgcactgactacgggtactgggtgaca
ccttcaccaattccggacggcccgatgaccgttcgcgtgactgaccaatacggtcgctcg
gtcgttctccccggaatccgaatggcaccaggggagacccagagtacggcgcgccggatc
tatcagatgcactga

DBGET integrated database retrieval system