KEGG   Cordyceps militaris: CCM_00448Help
Entry
CCM_00448         CDS       T03108                                 

Definition
(RefSeq) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmt  Cordyceps militaris
Pathway
cmt00052  Galactose metabolism
cmt00500  Starch and sucrose metabolism
cmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CCM_00448
   00500 Starch and sucrose metabolism
    CCM_00448
Enzymes [BR:cmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CCM_00448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 18162483
NCBI-ProteinID: XP_006665671
UniProt: G3J472
Position
Unknown
AA seq 580 aa AA seqDB search
MYWLQPICLASTLSLANICLAANTTSTSGNLSVSTYVDPNVPTGVPIVGEYDGRYRPQIH
YSPPKHFMNDPNGMFRDDEGVWHLYYQYNPTGIVAGNQHWGHATSEDLYHWVNQPISLFP
PKKTQYIFSGSAVTDPNNTSGFFPSQKNGVVAIYTLAEYGEDGSPGPQTQAIAYSHDGGY
TFTPYQRNPVISSNSSQFRDPKVIWYKDHWVLVIAYAQEYEIGIFTSPDLKEWKHASNFS
HTGLLTLQWECPNLVQMPYLDSNGKKQDDMWLLAISVNPGAPLGGSITQYYPGHFNGTHF
AAVDNAARILDFGKDNYAGQFFYGTAEDEPPVFLGWASNWQYTQVVPTGEEGWRSAMTVP
RRSYLTKAKRVGWKLVTEPYDLEPVMGSLLASNTSMVNGSLTVDFARVDSNALYWEANIT
GLPATGISESATLNFTFIAPQTGEFVRGGYYLGGDTPFFIDRGGAKGFDNVFFTDKFSTN
SLTDGSSWRMSGILDRSILEVFLDGGIESATVNYFTTQPLTLMVVGTSSMPDGANVSVSV
YALESAWAKMANERDGLVYGNQTGNGTACETKSRLFGIAL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtactggctgcagcccatctgcctggctagcaccttgagcctggctaacatctgcctg
gctgccaacacgacatcgacttctggcaatctttccgtatcgacctatgtcgaccccaat
gtccctaccggggtgcccattgtcggcgagtatgacggccgctatcgcccacagattcat
tattctccacccaaacacttcatgaatgatcccaacggcatgttcagagatgacgagggc
gtatggcatctttattatcaatataatcctaccggaattgttgctggaaatcaacactgg
ggccatgccacctccgaggacctctaccactgggtaaaccagccgatttccctctttccg
cccaagaagacccagtacatcttttctggcagtgctgtcactgatcctaacaacacgtcg
gggttctttccgagccagaagaacggtgttgttgcaatttatacccttgccgaatatggc
gaagacggcagcccagggccgcagacccaggctatcgcgtactcccacgacggaggatac
accttcacgccatatcaaagaaacccagtcatctcaagcaattcttcgcagtttcgcgac
cccaaggtcatctggtacaaggatcactgggtgctggtgatcgcctatgcccaagaatac
gagatcggtatcttcacctctccggacctcaaagagtggaagcatgctagcaacttctct
cacaccggtcttttgactctgcaatgggaatgccccaaccttgtgcaaatgccttaccta
gattccaacggcaaaaagcaggacgacatgtggctgctggcaattagcgtcaaccctggc
gcgccgctcggcggctccattacccagtattatcccgggcacttcaacggtacgcatttt
gcggccgtcgacaacgccgctcgaatcttggatttcggcaaagacaactacgccggccag
ttcttctacggcacggccgaggacgaaccgcctgtgttcttgggctgggcctcgaattgg
caatacacgcaagtcgtgcccacaggcgaggaaggctggcgaagcgccatgacagtgccg
cgtcgctcctacctaacaaaggccaagcgtgtcggctggaagctcgtgacggagccgtac
gatctggagccggtcatgggctccctgctggccagcaacaccagcatggtgaatggcagc
ctcaccgttgactttgctcgtgtcgattcaaacgcgctctactgggaagcaaacatcacg
ggactccccgcaacgggtatttccgagtcggcaacgctcaactttaccttcatcgcgccc
cagacgggcgagttcgtccgcggcggctactatctcggtggcgacacccccttcttcatt
gatcggggcggcgccaaaggctttgacaatgtattcttcaccgacaagttctcgacaaac
agcttgacggacgggagttcgtggcggatgagcggaatccttgacaggtccattctggaa
gtgtttctcgatggcggaattgaaagcgcaacggttaattacttcacgacgcagccactc
actttgatggtcgtgggtacgtcgagtatgcccgatggcgccaatgtcagcgtcagtgtg
tatgcgctggagagtgcatgggcgaagatggcaaacgagagggatgggctagtatatggt
aatcaaactgggaacggtactgcctgtgaaacgaaaagccggttgtttggtatcgccctg
tga

DBGET integrated database retrieval system