KEGG   Cordyceps militaris: CCM_03826Help
Entry
CCM_03826         CDS       T03108                                 

Definition
alkaline phosphatase, putative
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cmt  Cordyceps militaris
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCM_03826
Enzymes [BR:cmt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CCM_03826
Exosome [BR:cmt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCM_03826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 511 aa AA seqDB search
MLYRLSSVVAAGTLMLLGSVGGATCVPRARSFIYVVPDGYGPVSQTMARDYESITTGKST
LGRPNSAQIGVDKMLIGTVRTQASDNIVTDSAASATAFACGIKTYNGDLAVGVDDDGHPV
ASVLEAAHLSGFKTGLVATSRITHATPAGYSSHVLNRDSENEIAAQQIGHAHSFGAYVDL
LLGGGRRHYLPSKAGGLRTDGVDLVAWAKGEGYNYAADRAAFDGAAVGGKLPLPFLGLFA
GSHMAYELDRDDQKEPSLLDMTKVALASLEDASKGAQQGYFVMIEASRIDHAGHSNDAPG
HIHDILMYNNVMTYLQEYVAAHPDTQLLSAADHECGGLTLPGQWDPQPLAAATRTSEHLV
GLLAGYKGDDQRGYFRTELLPQYGLAGATDGVVDGLLATYKKSGSTALIVAMGNELSRKA
GINWSTTGHTGVDVNLYGAAKAQGSMAALIGGNRDNTELPRYVEKALGVSMTNATAQLRA
TEAAGRWKVQRREDLAAIKRAANLAAWNHMP
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatcgtctgtcctcggtcgtcgccgccggcactttaatgctgctcggctccgtg
ggcggggccacgtgcgtgccgcgcgcgcgcagcttcatctacgtggtgcccgacggctac
gggcctgtgtcgcagaccatggcgcgggactatgagagcatcacgacgggcaagagcaca
ctgggccggcccaactcggcgcagattggcgtcgacaagatgcttatcggtacagtccgc
acgcaagcctcagacaacatcgtgaccgactcggcggcgtctgctacggcatttgcctgc
ggtatcaaaacttacaatggagatttagcggttggtgtcgacgacgacggccaccccgtt
gcttctgtgctggaagcggcgcacctcagcggcttcaagacgggcctggttgcgacgtca
cgcatcacgcacgcgacgccggcgggctacagctcgcacgtgctgaaccgtgactcggag
aatgagattgctgcgcagcagataggtcacgcacactcgtttggcgcgtacgtggaccta
ttgctcggcggcggacggcggcattacctgccgagcaaggccggcgggctgcgcaccgac
ggcgtggacctcgtggcgtgggccaagggcgagggctacaattatgcggcagaccgggca
gcctttgacggtgccgccgtcggtggtaagctaccactgccatttctcggactgtttgcc
ggcagccacatggcgtacgagctggaccgcgatgaccaaaaggagccatcgctactggac
atgaccaaggtggcactggcgtcgctcgaggacgcctccaaaggcgcgcagcagggttat
ttcgtcatgattgaggcgtcgcggatcgaccacgcaggccactccaacgacgcgccgggt
catatccacgatatcctcatgtacaacaacgtcatgacctatctgcaagagtacgtcgcc
gcacatccggacacccagctgctatcggccgccgaccatgagtgcggcggactgacgctg
cccgggcagtgggatccgcagccgctcgccgcggccacgcgcaccagcgagcacctcgtc
ggactgctcgccggatacaagggtgacgaccagcgcggctatttccggacggagctgctc
ccacagtatgggctggcgggcgcgacggacggcgtggtggatgggctgctggccacgtat
aagaagagcggcagcaccgcgctgattgtggccatgggcaacgagctctcgcgcaaggcc
ggcatcaactggtcgacgacgggccacacgggagtcgacgtcaacctgtatggtgcggca
aaggcgcagggcagcatggcggcgctgattggcggcaatagggataatacggagctcccg
cggtacgtggaaaaggcgctgggcgtgagcatgaccaatgccacggcacagctcagggcc
acggaggcggccggcagatggaaggtgcagcgcagggaggacctagcggcgattaagagg
gcagccaacctggcagcgtggaatcatatgccctag

DBGET integrated database retrieval system