KEGG   Cordyceps militaris: CCM_08034Help
Entry
CCM_08034         CDS       T03108                                 

Definition
(RefSeq) cytochrome b5 reductase, putative
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cmt  Cordyceps militaris
Pathway
cmt00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cmt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CCM_08034
Enzymes [BR:cmt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CCM_08034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 18170043
NCBI-ProteinID: XP_006673236
UniProt: G3JPH1
Position
Unknown
AA seq 457 aa AA seqDB search
MDYDSRQVAEHKVATDAWMTINGKVYDVTKYLQDHPGGAEVLAEAAGTDATEAFDNAGHS
EDALDIMDTFQIGSLKGYKKKPQRKAVNVTPVSAPEKPASSNTRALLSKLGSVGLFSVAV
TGVYLGARYYGPATPTWVLSVLNNETPGRHGFGFTKGLLAGAGLFAVVDAVLAQQFTRLA
QQSASFTSYPAHMKVPAPVQQDTLLQRGLLDPATYAPLPLRAKTQVAPNVYRFTFALPAT
DTVLGLPIGQHVAIKADVDGESVARSYTPVSNNADRGVLELVVKAYPDGKLTSGYLARLA
VGDEVLFRGPKGAMRYAPGLARRVGMVAGGTGITPMFQLIRAICEHDRDLTTVSLIYANR
TEQDILLRDELDAFARRYPKQFSVYYLLDQPPEGWAYGTGYCTQELIEEKLPRPSADTKM
MLCGPPGMVTAAKNDMVNLGFEKPGAMAKMTDQIFLF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggactacgactcaagacaagtagccgagcacaaggtggcaacagatgcctggatgaca
atcaacggcaaagtctatgatgtgacaaaatatttgcaagaccacccaggtggtgcggaa
gtgctagcagaggccgctggcacagacgccacagaagcctttgacaacgccggccactcc
gaggacgccctggacatcatggacacgttccaaatcggcagcctcaagggttacaagaag
aagccccaacgcaaggccgtgaacgtgacacccgtctcagcgcccgagaagccagcgtca
agcaacacgcgggcgctcctgtccaagctcggcagcgtcggcctcttctccgtcgcagtc
acgggcgtatacctcggcgcgcgctattacggccccgcgacgccgacctgggtgctgtcc
gtcctcaacaacgagacgcccggccggcacggcttcggcttcaccaagggcctgctcgcg
ggcgcgggcctcttcgccgtcgtcgacgccgttctcgcgcagcagtttacgcgcctcgcg
cagcagagcgcgtcctttaccagctacccggcgcacatgaaggtgccggcgccggtgcag
caggacacgctgctgcagcgggggctgctggacccggcgacgtacgcgccgctgccgctg
cgggccaagacgcaggtggcgcccaacgtgtaccggttcacgtttgcgctgccggcgacg
gacacggtgctcgggctgccaatcgggcagcacgtggccatcaaggccgacgtggacggc
gagagcgtcgcacgctcgtacacgcccgtgtccaacaacgcggaccgcggcgtgctcgag
ctcgtcgtcaaggcgtaccccgacggcaagctgacgagcggctacctggcgcgcctcgcc
gtcggcgacgaggtgctgttccgcgggcccaagggcgcgatgcgctacgcgccggggctc
gcgcgccgcgtcggcatggtcgctggcggcaccggcatcacacctatgttccagctcatc
cgcgccatctgcgagcacgaccgcgacctcaccaccgtcagcctcatctacgccaaccgc
accgagcaggacatcctgctgcgcgacgagctggacgccttcgcgcgcaggtacccgaag
cagttttccgtctactacctgctcgaccagccgccagagggctgggcgtacggcacaggg
tactgcacgcaggagctcatcgaggagaagctgccgcgaccgagcgcggacaccaagatg
atgctgtgcgggccgccgggcatggtcaccgcggccaagaatgacatggtcaatctgggg
tttgagaagccgggggccatggcgaaaatgacggaccagattttccttttttaa

DBGET integrated database retrieval system