KEGG   Chlamydia muridarum Nigg: TC_0121Help
Entry
TC_0121           CDS       T00028                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cmu  Chlamydia muridarum Nigg
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TC_0121 (hemY)
Enzymes [BR:cmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TC_0121 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(145681..146955)
Genome map
AA seq 424 aa AA seqDB search
MKHALVVGSGIAGLSAAWWLHKRFPHMQLSILEKESRPGGLVVTEKQKGLFFNMGPKGFV
VSHDGKHTLHLIQSVGLSDDLIYSSPAAKHRFIHYKNKTRKVSPWTIFKQNLPLTLIKDL
FARPYKQDSSVEAFFKRHSSTKLRTHLLNPINLAMRAGHSHILSAQMAYPELTRREAEMG
SLLRSYLRDFPRTARKGPYLATLRSGMESLIQTLHDKLPATWYFSTPVTKIRQLSNGKIS
LSSSQGEITGDILIYAGSVQDLPSCLEEIPESALVKQTTSSWDLSCVALGWHSSLPLPHG
YGMLFADTPPLLGIVFNTEVFPNSQQPSTTLSLLLEGRWHQEEAYAFSLATISEYLQIYT
PPQAFSLFSPKEGLPQHHVGFIRSRKILLSKLPPNIKIVGQNFAGPGLNRATASAYESIA
SLRP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgcattagttgttggttctggtattgcaggactctctgcagcatggtggctg
cacaaacgcttcccacatatgcaattgtccatcctagaaaaagaatctcgtccgggagga
cttgtcgtcactgagaaacaaaaaggtctttttttcaatatgggacctaagggctttgtt
gtatcccatgatgggaagcataccctccatctcatccagtctgtgggcttatcagacgat
cttatatatagctcccccgcagctaaacatcggtttattcactataaaaataaaactcga
aaagtttctccttggacaatttttaaacagaatctccctcttactcttattaaagactta
tttgctcgtccttataaacaagatagctctgtagaagcttttttcaaaaggcacagctct
accaagctaagaacacaccttctaaaccctattaatctggctatgcgagcaggacatagt
catatactgtctgcacaaatggcttacccagaattaactcggcgagaagctgagatggga
tctttactacgtagttatctcagagatttccctagaaccgctcggaaaggcccttatcta
gctaccttacgttctggaatggaaagtttaatccaaacgctgcatgataaacttcccgct
acatggtacttctccacgcctgttacgaaaattcgtcagttatctaatgggaaaatctct
ctttcttcttctcagggagagataaccggagatatactcatttatgctggatctgttcaa
gatctcccttcttgcttagaagagattcctgaatctgcactagtgaaacaaaccacctct
tcttgggatctttcttgtgtagccttaggatggcatagttcgctccccctccctcatgga
tatggcatgctttttgcagatacgcctcctttacttgggatcgtttttaacacagaagta
tttcccaattctcagcaacctagcacgactctctctctccttttagaagggcggtggcac
caagaagaagcttacgcattctctctagcaaccatttctgagtatctgcaaatttatacc
cctcctcaagccttttcgctattttctcctaaagaagggctccctcagcatcatgttgga
tttattcgatcgcgaaaaattctcttatccaaacttcccccaaacataaaaattgtggga
caaaattttgctggaccaggactgaaccgtgcaacagcatccgcctacgaatctattgct
tctttacgaccatga

DBGET integrated database retrieval system