KEGG   Chlamydia muridarum: TC_0257Help
Entry
TC_0257           CDS       T00028                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cmu  Chlamydia muridarum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cmu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
299702..301915
Genome map
AA seq 737 aa AA seqDB search
MDPFFLNTQHVELLVSGKQSSPQDLLGIVSESLNQDRIVLFRPGAKTVFVELQGKIQQAE
SHHSGIFSLPVTKGISPQDYRVYHQNGLLAHDPYAFPLLWGEIDSFLFHEGTHQHIYDRM
GAIPCEIGGVPGVRFVIWAPHAQRVSVVGDFNCWHGLVNPLHKVSDQGVWELFVPGLTAG
SCYKWEIVTASGQVLIKSDPYGKFFGSPPQSVSVVVDDRYEWGDKEWLDERSKKAEGPMN
IYEVHVGSWRWQEEQPLNYRELADQLSLYCKQMHYTHVELLPVTEHPLNESWGYQTTGYY
APTSRYGSFEDLQYFIDTMHQHGIGVILDWVPGHFPVDSFAMSNFDGTPLYEYTRNPSPL
HPHWHTYTFDYAKPEVCNFLLGSALFWIDKMHIDGIRVDAVSSMLYLDYGRNPGEWIPNR
YGGRENLDAVRFLQQFNTIIHEKYPGVLTFAEESTTFPKITVSVEEGGLGFDYKWNMGWM
HDTLHYFEKDFPYRPYHQSDLTFPQWYAFSERFLLPFSHDEVVHGKRSLIGKMPGDAWRQ
FAQLRLLLGYQICQPGKKLLFMGGEFGQGREWSPNRELDWDLLDIHYHQGVHLCSQKLNS
LYVNSPQLWKGDHLPQSFRWIDFSDTRNGVVAYLRFASDEDKEALLCVHHFGVNHFLHYI
LPMLPMKSCSLLMNTDDLAFGGSGKGFRNPKMLTPEMVRKEKTSSELAPLDDDGSVAWGL
DIEMPPSATLIFSVTLQ
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
gtggatcctttcttcttaaatacacaacatgtagagcttcttgtttcagggaaacagagt
agcccgcaagatcttttaggaattgtttctgaaagtctgaatcaggatcggatagttctt
tttcgtcctggagcaaagactgtttttgttgagctgcaaggaaagattcagcaagcagaa
tcgcatcattcagggattttttctctccctgtcacgaaaggaatttctcctcaagactat
cgagtgtatcatcaaaatggtctattagctcatgatccctatgcatttcctttgctttgg
ggagaaatcgattcttttttattccatgaagggacccatcagcatatctatgatcgcatg
ggtgctattccttgtgaaattggaggggtgcctggagtgcggtttgttatttgggctccg
catgctcaaagagtttctgttgttggagattttaactgctggcatggacttgttaaccct
cttcataaagtttcagatcaaggagtttgggagttatttgttcctggcctcacggcaggt
tcttgttataagtgggaaatagttacagcatctggtcaggttcttatcaaatctgatcct
tatggtaaattttttggatctcctccgcaaagcgtttctgttgttgtggatgatcgctat
gagtggggagataaagagtggttagacgagcgctctaaaaaagccgaaggccctatgaat
atttatgaagtgcatgtagggtcttggagatggcaagaagagcagcctttaaattataga
gagttagctgatcaactgtccctctattgtaagcagatgcattatacgcatgtggagttg
ctccctgtaacagagcatcctttgaatgaatcttggggatatcaaacaacaggatattat
gctccaactagtcgttacggttcttttgaggatttacagtattttatagataccatgcat
cagcatggtattggggttattttggactgggttccgggacatttccctgtagattctttt
gcaatgagtaattttgatggtacaccattatacgagtatactagaaatcctagtccattg
catcctcattggcatacatatacctttgattatgccaagcctgaggtttgtaatttctta
ttagggagtgctctattttggatagataaaatgcatatagatggtatccgagtcgatgct
gtttcttccatgctttatcttgattatggacgaaatccaggggagtggattccgaatcgc
tatgggggaagagaaaaccttgatgcagtccgttttcttcagcaatttaacacaatcatt
catgagaagtatccaggtgtcttgacctttgctgaagagtctacaacattccccaagatc
actgtgtctgtggaagaaggaggattaggttttgattataaatggaatatgggctggatg
catgatacattgcattattttgaaaaagattttccttaccggccatatcatcaaagcgat
ctgactttccctcagtggtatgcctttagtgaaaggttcttgctaccattttctcatgac
gaggtagttcatgggaaacggagtttaattggtaaaatgcctggggatgcctggagacag
ttcgctcagttacgtttgctattggggtatcaaatctgtcaaccagggaagaaattgctc
tttatgggcggagaatttgggcaaggacgagagtggtcgccgaatcgcgaattggattgg
gatttattggatatccattaccatcagggagtacatttatgctctcaaaagttaaactcc
ttatatgtgaatagccctcagttgtggaaaggagatcatttaccacagagttttcgttgg
atagattttagtgatactcgtaatggtgttgttgcttatttgcgatttgcttctgatgag
gataaggaagcattgctttgcgtgcatcattttggcgtgaatcatttccttcattacatt
ttaccgatgctccctatgaaatcgtgttctttgcttatgaatacagacgatttagcgttt
gggggatcgggcaaaggttttcgaaatcccaaaatgttaactcctgaaatggttagaaaa
gagaaaacctcttcagaactagctcctctggatgatgatggtagcgttgcttggggatta
gatatcgagatgcctccgtcagcaacgctcattttttctgtaacactacaataa

DBGET integrated database retrieval system