KEGG   Chelonia mydas (green sea turtle): 102930669Help
Entry
102930669         CDS       T02989                                 

Gene name
JOSD1, Josephin-1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102930669 (JOSD1)
Peptidases [BR:cmy01002]
 Cysteine Peptidases
  Family C86
   102930669 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 202 aa AA seqDB search
MSCVPWKGDKTKSESPEPPQLAPLRIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKMPEWIGGESELRKFLKHQLRGK
NCELLLVVPEEVEAHQSWRADM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggtgacaaaaccaaatctgagtctcctgagccaccacag
ctggcaccactacgtatttaccatgagaaacagcgtagggagctgtgtgctctccatgcc
ctcaataatgtcttccaggacagcaacgccttcacccgggaaacactgcaagagattttc
cagagactgtctcccaacactatggtgacaccacacaagaagagcatgctgggaaacgga
aactatgatgtgaatgtcatcatggcagcgcttcagaccaaaggctatgaagcagtttgg
tgggacaagcgcagggatgttaatgtcattgccctctctaatgtgatgggcttcatcatg
aatctgccctccagcctctgctggggtcccctgaagctcccccttaaacgacagcactgg
atctgtgtccgggaggtgggaggcacctactacaatctcgactccaaactcaagatgcca
gagtggattggaggtgaaagtgagctcaggaaatttttgaaacaccagctgagaggaaag
aactgtgaacttctgctggtggtgccagaggaggtggaagcacatcagagctggagagct
gacatgtga

DBGET integrated database retrieval system