KEGG   Chelonia mydas (green sea turtle): 102933767Help
Entry
102933767         CDS       T02989                                 

Gene name
ABAT
Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    102933767 (ABAT)
   00650 Butanoate metabolism
    102933767 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102933767 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102933767 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102933767 (ABAT)
Enzymes [BR:cmy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102933767 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102933767 (ABAT)
Amino acid related enzymes [BR:cmy01007]
 Aminotransferase (transaminase)
  Class III
   102933767 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MALMLLSRQLTCSLQQNSRLFACGHRLISQTAAKIDVDFDYDGPLMKTEVPGPRSRELMK
QLNGIQNAEAVHFFCNYQESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPSLIKLLQQPQ
NLSTFINRPALGILPPGNFAETLKESLLSVAPKGLQQVVTMSCGSCSNENAFKAIFMWYR
NKERGNNNVTKEELETCMINQSPGCPDYSILSFMGGFHGRTLGCLATTHSKAIHKLDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKIVAGIIIEPIQSEGG
DNHASDDFFRKLRDITRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVVTFSKKMM
TGGFFHKEEFRPDGPYRIFNTWLGDPSKNLMLVEVLNVIKREDLLNNAAHAGKALLAGLL
DLQARYPHLISRARGRGTFCSFDTPNDATRTKLIAIARNKGVVLGGCGDRSIRFRPTLIF
KDHHAHLFLNVFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccttgatgttgctcagtcgacagctgacttgttctctgcaacagaactccaggcta
tttgcatgtgggcacagattgatcagtcagactgcagctaaaattgatgtggactttgat
tatgatggaccattaatgaagacagaagttcctgggcctaggtccagagagttaatgaaa
cagctaaatggaattcagaatgcagaagctgtgcactttttttgcaattatcaagagagc
cgagggaactaccttgtagacgtagatggcaaccgcatgctggatctctactctcagatt
tcatccatcccaataggttacagccatccatctctgataaaacttctccagcagccacag
aacttgagtacatttattaacagacctgctcttgggattttacctccagggaattttgct
gaaaccttaaaggaatctttgctttcggtggctccgaagggcctgcaacaggttgtcacc
atgtcttgtggatcctgctctaatgaaaatgcctttaaagcaatattcatgtggtacagg
aacaaagaaaggggtaataataatgtcacaaaggaagaactggagacatgcatgattaac
cagtctccaggctgccctgactatagtattctgtcctttatgggtggattccatggaaga
accctgggttgcttagctacaactcactctaaagcaattcacaaattagacattccatca
tttgactggccaattgctccattcccaagactaaaataccccctggaagagtttgtgaaa
gagaatcaacaggaagaagcccgctgtttagaagaggtggaagatctgattgtaaagtac
aggaaaaagaagaagattgtggctggaataatcattgaaccaattcagtcagagggggga
gacaatcatgcttcagatgacttcttcaggaagctacgggacattaccagaaagcatggc
tgtgcatttctggtggacgaggtgcagacaggaggcggctgcactgggaagttttgggcc
catgaacactggggcctagatgacccagctgatgtggtaacatttagtaagaagatgatg
acaggaggattttttcacaaggaggagttcaggcccgatggtccatatcggatttttaac
acctggcttggagatccctccaagaacctcatgcttgttgaagtccttaatgttattaag
agggaagatcttctaaacaatgcagcccatgcagggaaagctctactggccgggctgctg
gacttgcaggctcgttacccccatctcatcagcagagcaagagggcgagggacattctgt
tcgtttgacactccaaatgatgcaactaggaccaagctaattgcaatagccagaaacaaa
ggtgttgtcctgggaggctgtggtgacagatcaatccgtttccgcccaactctgatcttc
aaggatcaccacgcgcacctctttctgaacgtcttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system