KEGG   Chelonia mydas (green sea turtle): 102935931Help
Entry
102935931         CDS       T02989                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102935931
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102935931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 132 aa AA seqDB search
PGCRGLVVPRCQLVRILRQHGLEGFGRRSGADWVCLARPKSCYNTQAIDRNKDGSSDCGI
FQINSKYWCYDGRTPGASNGCHMPCSKLLDNNIADDIRCAKLNARKARGLMPWVAWKKRC
RGKDLKPNVRGC
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
cccggctgccggggcctcgtcgttccccggtgccagctggtgcggatcctccggcagcac
gggctggagggcttcggcaggagatcgggggctgattgggtctgcctggcaaggcccaag
agttgttacaacacccaggccatcgaccgcaacaaggacggcagctcggactgtgggatc
ttccagatcaacagcaagtactggtgctacgacgggcgaacgccgggggcaagcaacggg
tgccacatgccctgcagcaagctcttggataacaacatcgcggacgacatcagatgtgct
aagctcaacgcaaggaaagcgcgcggcctcatgccctgggtcgcgtggaagaaacgctgc
aggggaaaggatttgaagccaaacgtcaggggatgctag

DBGET integrated database retrieval system