KEGG   Chelonia mydas (green sea turtle): 102935981Help
Entry
102935981         CDS       T02989                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102935981 (DBH)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102935981 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 598 aa AA seqDB search
MYFTMIMVFLVILVVALQGTAPRENYFPYKVPLDPQSFLELSWNVSYPEQVVHFQLLVKE
PKFGLLFGMSDRGEFENADLAVLWSDGHSSYFGDAWSDEKGQLHMDSQQNYQLLKAHRTP
EGLYLVFKRAFSTCDPKDYLIEDGTVHLIYGILEKPVRSLQAINLSAIHRGVQRVQLLKP
NISAPELPRDMKTMEVRAPNVVIPSQETTYWCYMVELPDSFPRHHIVMYEPVITAGNEAI
VHHMEVFQCAAEFDSFPHYNGPCDSKMKPDRLNYCRHVLAAWAMGAQAFYYPEEAGLAFG
GPGSSKYLRLEIHYHNPLVFKGRHDSSGIRLYYTATLRRYDAGIMELGLVYTPVMAIPPG
EAGFLLKGYCTDKCTQVALPPAGIHIFASQLHTHLTGRKVVTILSREGREREVVNADNHY
SPHFQEIRMLKKVVSVFPGDVLTTTCTYNTEDRNQATVGGFSITDEMCVNYVHYYPQTQL
ELCKSAVDLGYLQRYFNLVNRFNDEEICMCPQASIRQQLSSVPWNAFNRDVLKSLYDFAP
ISMHCNKSSAVRFPGEWEKQPLPRITRVLPESAPSCQPAVGPPPASPALVNLGRVKAE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcaccatgattatggttttcctggtcatcctggtggtggctctgcaaggcaca
gctccccgggagaattatttcccttacaaggtgcccctggatccccagagtttcctggag
ctctcgtggaatgtcagctacccggagcaggtggtgcatttccagctcttggtcaaggag
ccgaaatttgggctgctcttcgggatgtcggacaggggcgagtttgagaacgcggacctg
gccgtgctctggagcgacgggcacagctcctattttggggatgcgtggagtgatgagaaa
gggcagcttcacatggattcccagcagaactaccagcttctcaaagcacacagaaccccc
gagggactctacctggtcttcaagagagccttcagcacctgtgatccaaaggactacctt
atagaggatggtaccgtgcaccttatctacgggatccttgagaaacccgtccgttctctc
caggcaatcaacctctctgccatccacaggggggtgcagagggtgcagctgctgaagcca
aacattagcgccccggaactgcccagggacatgaagaccatggaggtcagagcccccaac
gtggtcattcccagccaggagaccacatactggtgctatatggtggagcttccggacagc
ttcccgagacatcacattgtcatgtacgagccagtgatcacggcaggcaacgaagctata
gtccatcatatggaagtcttccagtgtgctgcagaatttgacagcttcccacattacaat
gggccctgtgactccaagatgaagccggaccgactgaactactgcagacatgtgcttgca
gcgtgggccatgggagctcaggccttctactatccagaagaggcaggacttgcctttggt
ggtccgggctcctccaaatatttacggcttgagattcactaccacaaccctctggtgttc
aaaggtcgccatgactcctcggggattcgcctctattacacagccacgctgagacgctat
gatgctggcattatggagctgggcctggtctacacgccggtgatggctatcccacctggg
gaagctggtttcctcctgaaagggtactgcacagataaatgcacccaagtggctctgccc
ccggctgggatccacatctttgcctcccagctccacactcacctgacgggaagaaaggtg
gtgacgattttgtcccgagaagggagagaaagggaagttgtgaatgcggacaatcactac
agccctcacttccaggagatccgcatgttaaagaaagtggtttctgtcttcccgggcgat
gttctcacaacaacctgcacgtacaacacagaggacaggaaccaagcaactgtgggtggg
tttagcatcacggacgagatgtgtgtcaactacgtgcactattacccccagacgcagctg
gagctatgcaagagcgctgtggatttaggctacctgcaaagatattttaatctcgtgaac
aggtttaacgatgaggagatctgcatgtgcccacaggcctccatcaggcagcagttgtct
tccgtcccttggaatgcgttcaacagagacgttctgaaatctctctatgactttgctccg
atctctatgcactgcaataaatcctcagcagttcgtttcccgggcgaatgggagaagcag
cctctgcccaggatcaccagggtgctgccggaatcagccccaagctgccagcccgccgta
ggacctcctcccgcatcccctgctctcgtcaacctaggcagggtaaaggcagaatga

DBGET integrated database retrieval system