KEGG   Chelonia mydas (green sea turtle): 102941285Help
Entry
102941285         CDS       T02989                                 

Gene name
CHKB
Definition
(RefSeq) choline kinase beta
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00564  Glycerophospholipid metabolism
cmy01100  Metabolic pathways
Module
cmy_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
cmy_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102941285 (CHKB)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102941285 (CHKB)
    2.7.1.82  ethanolamine kinase
     102941285 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH BTB EcKinase
Motif
Other DBs
NCBI-GeneID: 102941285
NCBI-ProteinID: XP_007066644
Position
Un
AA seq 461 aa AA seqDB search
MFAILAERALGPRLYGVFPQGRLEQYIPSRRLCTEDLQDPDISREIAMKMSRFHGMVMPF
NKEPKWLFGTMERYLKQIAELTFPQEAQRKLFNQLKAYNLQKGMGSLRELLESTPSPVVF
CHNDVQEGNILLLAGRESHPSDKLMLIDFEYSSYNYRGFDIGNHFCEWVYDYTHDTWPFY
QASMENYPTRQQQLHFIRHYLWEDSVRRGDTTQEEQARIEEEMLTEISRFALASHFFWGL
WSILQAKISTIEFGYLDYARCRFEAYFQQKAQCLFFLLPSKGPDSRAPRAEPWESSPEQR
VYGIQGAGLPFRTVQTDPCAFQVELARLAEESAYFGALARSLMQEAAQGRLVLEHVPSGA
FRAILEFVFLGHFGLGEEELLPAVQAASYLLVPSFLEQCWLALRPGNCLSYLRFAEAIGR
PEMRAVLCQFLSAQLLELAPFAGQLAPALPEELAWHTCRIR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccatcctggcagagcgggcgctggggccgcggctctacggggtctttccccag
gggcggctggagcagtacattccgagccggcgtctgtgcacagaggacctgcaggacccc
gacatctccagggagatagcgatgaagatgtcccgcttccacggcatggtgatgcccttc
aacaaggagcccaagtggctgtttgggaccatggaacggtacctgaagcagattgccgag
ctcaccttccctcaggaagcccagcggaagttgttcaaccagctcaaagcctataacctg
cagaaggggatggggagcctcagggagctgctggagtccacgccctcccctgtggtcttc
tgccacaatgatgtgcaggaagggaacatcctgctgctggctgggcgcgagtcacacccc
agcgacaagctgatgctgattgactttgaatacagcagctacaactacaggggctttgac
attggcaatcacttctgtgagtgggtgtacgactacacccacgacacgtggcccttctac
caggcctccatggagaactaccccacgcgtcagcagcagctgcatttcatccggcactac
ctgtgggaggactcggtgcggcgcggggacaccacgcaagaggagcaggcccgcatcgag
gaggagatgctcaccgagatcagccggtttgctctggcctctcacttcttctggggcctc
tggtccatcctgcaggcgaagatttccaccattgagttcggctacctggattacgcgcgg
tgccgtttcgaggcctacttccagcagaaggcgcagtgcctcttcttcctgctgcccagc
aaggggccggacagccgggcgccacgggcagagccctgggagagcagccctgagcagagg
gtctacgggatccaaggggcagggctgcccttcaggaccgtccagacagatccctgtgcc
ttccaggtggagctggcccggctggctgaggagagcgcgtatttcggggcgctggcacga
tccctgatgcaggaggctgcgcaggggcggctggtgctggagcacgtcccatcgggtgcc
ttccgcgccatcctggagtttgtcttcctggggcacttcgggctgggtgaggaggagctg
ctgcccgccgtccaggctgccagctacttgctggtgccctccttcctggagcagtgctgg
ctggccctgcgccccggcaactgcctgtcctacctgcgctttgccgaggccatcggccgc
ccggagatgcgggccgtgctgtgccagttcctgagcgcccagctcctggagctggcgccc
ttcgcggggcagctggccccggcgctgccggaggagctggcatggcacacctgtcggata
cgatga

DBGET integrated database retrieval system