KEGG   Chelonia mydas (green sea turtle): 102943513Help
Entry
102943513         CDS       T02989                                 

Gene name
ALDH1L2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102943513 (ALDH1L2)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102943513 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 708 aa AA seqDB search
MDVIDSPKHGSIIYHPSILPRHRGASAIHNWIRGHDKVPGAWTVIDGQMVTFYGSSLLDG
PVPPGQPLAIKGTTKSGLITKNGLVLFGNDGKMLLVRNLQFEDGKMIPASKYFSSDEMSV
IELTEEEKKIFYTFXSIWKGILSNVALIEDSTDFFKSGASSMHVVRMIEEIKQKYGGLQL
QNEDVYMATKFADFIQMAVRKLRGEDEEEELVIDYVSKNVNNMNVKMPYQCFINGQFMNA
EEGKTYDTINPTDGSIIAKVSYASVADVDKAVAAAKDAXXXXXXXXXTGMXGVLLYLLAD
LMEEHQEELATIEAIDSGAVYTLALKTHVGMSVQTFRYFAGWCDKIQGSTIPISQARPNH
NLTFTKKEPIGVCAIVIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSA
KAGFPKGVINILPGSGGLVGQHLSEHPDIRKLGFTGSTLIGKQIMKSCAVSNLKKVSLEL
GGKSPLIIFEDCELDKAVRMGMGAVYFNKGENCIAAGRLFVEESVHDEFVRRVVEEIKKM
KIGDPLDRATDHGPQNHKAHLEKLLEYCEIGVKEGATLVYGGRQVCKPGFFMEPTVFTDV
EDHMYLAQEESFGPIMVISKFKNGDVDGVLKRANNTEYGLASGVFTRDLSKALYVSENLE
AGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALHEYLRTKAVTVEY
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggatgttattgacagtcctaagcatggatcaattatctaccatccatccatccttccc
cgccacagaggagcttcagctatccataactggatccgagggcatgataaagtacctgga
gcttggacagtgattgatggccagatggttactttctatggatcatcattacttgatggg
ccagtgcctcctggacaaccgttggcaataaaaggcaccacaaaatctgggcttataacc
aaaaatggcctagttctttttggtaatgatggaaagatgttgttggtgagaaatctacaa
tttgaagatggaaaaatgatccctgcatctaaatacttttcatctgatgagatgtctgtc
atagaacttacagaagaggagaaaaagattttctatactttttagtccatttggaaggga
attttgagcaatgttgctctaattgaggattctacagacttcttcaaatctggagcatcc
tcgatgcatgttgtcagaatgattgaagagatcaaacaaaaatatggtggacttcagctg
caaaatgaagatgtgtatatggccactaagtttgcagactttattcagatggctgtgagg
aaactgaggggagaggacgaagaagaagaattagtcatagattatgtttcaaaaaatgtt
aacaatatgaatgtgaagatgccttaccagtgttttataaatggacagtttatgaatgct
gaagagggaaaaacatatgacactataaacccaacagatggatcaataatagcaaaggtg
tcttatgcttcagtggctgatgttgacaaggcagtagcagcagcaaaagatgcnnnnnnn
nnnnnnnnnnnnnnnnnnnnnacaggtatgtaaggggtgttgctatatttacttgctgac
ctgatggaagaacaccaagaggaattagcaacaattgaggccattgactcaggagctgtc
tacactttagctttgaagacccatgtaggaatgtctgtgcaaacattcagatactttgct
ggatggtgtgacaaaattcaggggtctacaatcccgattagccaagcacgcccaaaccat
aacctaacattcactaagaaggaacccataggagtctgtgcaattgttatcccctggaat
tacccattgatgatgcttgcatggaagagtgcagcatgcttggcggcaggcaacacgtta
gttctcaaaccagcacaggtgactcctttgactgccttaaagtttgcagagctctcagct
aaagcaggatttcccaaaggcgttataaatattctgcctggttcaggtggtttagtggga
cagcacttgtctgagcacccagatatccgcaaacttggatttactggttcaactcttatt
ggtaaacagatcatgaagagctgtgcagtcagtaatctgaagaaagtctcccttgaactt
ggtggtaaatccccactgatcatttttgaggactgtgaacttgacaaagctgtgagaatg
ggcatgggagcagtatacttcaacaagggagaaaactgcattgcagctggcagactgttt
gtggaagaatcagttcatgatgaatttgttaggagagtggtggaagaaatcaaaaagatg
aaaattggtgacccactcgatagagcaacagatcacggtccacagaatcacaaggctcat
ctggaaaagctgctggaatattgtgaaattggagtgaaagaaggagcgacattagtgtac
ggaggaagacaagtatgtaaaccaggtttcttcatggaacccactgtatttacagatgtt
gaagaccatatgtaccttgcccaggaagaatcctttggtcctattatggtaatttcaaag
tttaagaatggggatgtcgatggagtgttaaaacgtgcaaacaacacagaatatggctta
gcttcaggggttttcacaagagacctaagcaaagctctgtacgttagtgaaaatctagaa
gcaggaacagttttcattaacacatataacaaaactgatgtggcagcaccatttggtgga
ttcaaacaatctggctttggaaaagatttaggtgaagaagctcttcatgagtacctcaga
actaaagctgtaactgtggagtattaa

DBGET integrated database retrieval system