KEGG   Chelonia mydas (green sea turtle): 102943877Help
Entry
102943877         CDS       T02989                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102943877 (ALPL)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102943877 (ALPL)
Exosome [BR:cmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102943877 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 777 aa AA seqDB search
MDSGRDLQHCCSLALKPAGSTQHRSHSLAQKQHPKQRKSSSPSHRPTPLELANGARPREE
HPVPKPAETVPLPLALQGGLSSLVPLDSPALIIEEVELPSTQDAFPATRDLITMTAPRLP
RIRIKPLVPQRMAPSQGKEAMNWLSAPLVKLPAPLQLMPALSMLILCGAGPGHDGHAHQD
LLRRAACDLGLHAEEVVELEDPVVDILAPEGPSRVALPLIKTIQSNSKTICQPPASIRST
AKGVERKYFVPSKGPGPSLWLLCSHPAVALLSEKEENPQYWRNQAQQTLKTALKLQQLNT
NVAKNIILFLGDGMGVSTVTAARILKGQLQNMKGEESLLEMDKFPYVALSKTYNTNAQVP
DSAGTATAYLCGVKANEGTVGVSAAVTRAQCNTTAGNEVTSILKWAKGAGKSVGIVTTTR
VNHATPSAAYAHSANRDWYSDNEMPPEAIQQGCKDIAQQLFDNIPDIEVIMGGGRKYMFP
KNTSDVEYRDDDKYRGTRLDGKNLIDVWRDKKPKDKNAQYVWNRSDLLSLHLMEVDFLLG
LFEPMDMMYELDRNVQTDPSLTEMVQVAIKILQRNPRGFFLLVEGGRIDHGHHEGKAKHA
LYETVEMDRAIGQAGGMTSLEDTLTVVTADHSHVFTFGGYTPRGNPIFGLAPMHSDVDKM
PFTSILYGNGPGYKLVAGERENVSAVDYAHANYQAQSAVPLRQETHGGEDVAIFAKGPMA
HLLHGVHEQNYIPHVMAYAACIGQNTDHCRSGAHHSMVGPLPFLSTLTSVILLKFLF
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggactctggcagagacctgcagcactgctgctccctggcgctgaaaccggcaggatca
acccagcaccgctcccactccctggcacagaagcagcacccaaagcaaagaaagagcagc
tctccgtcccacagacccacccctctggagctagccaatggggcacgtcctcgagaggag
cacccagtgccaaagcctgcggagacggtaccattgcctttggccctgcaagggggactg
tcgagtctggtgccgctggactccccagccctcatcattgaggaggttgaactaccatcc
actcaggacgcctttccagccacaagggacctcatcaccatgacagcgccaaggttgcct
aggattcgcatcaagcctctggttccacagcgtatggcaccatctcaaggcaaagaagca
atgaactggctgtcggcaccactggtcaaactcccggcaccactccagctcatgccagca
ctctcaatgctgatcctgtgtggagcaggtcctggacacgatggccatgcccaccaggac
ctcctgcgcagagcggcatgcgacttgggtctgcacgccgaggaggtggtggagttagag
gaccctgtggttgacattctggccccagaaggtccttcgagggtggctctgcccctcatc
aagaccatacagagcaattccaagactatctgtcagcctccagcctccatccgttccaca
gccaagggcgttgagaggaagtactttgtgccctcaaagggacctggcccttctctctgg
ctcctgtgctctcaccctgctgtggctctgctttcagagaaggaggagaacccacagtac
tggaggaatcaggctcagcagacactgaaaactgccctgaagctgcagcagctcaacacc
aatgtggccaagaacatcatcttatttcttggagatggcatgggagtctccacagtcaca
gcagctcgtatcctcaaggggcagctgcagaacatgaagggggaagaatccctgctggaa
atggataaatttccttatgtggctttgtccaagacctacaacaccaacgcccaggtgcca
gacagtgcaggcactgccaccgcttatctctgtggggtgaaggccaacgaggggacggtg
ggcgtgagcgcagccgtgacccgtgctcagtgcaataccacagctggcaatgaggtcaca
tcgattctcaagtgggcgaagggagcaggcaagtctgtgggcatcgtcaccaccacacgg
gtaaaccacgccactcccagtgctgcctatgcccactctgctaacagggactggtattcg
gataacgagatgcccccggaggccatccagcagggttgcaaagatatcgcccagcagctc
tttgacaacatcccagacatcgaggtgatcatgggaggtggccggaaatacatgttccca
aagaacaccagtgatgtggaataccgggatgatgacaagtacaggggcactcgtctggat
ggcaaaaacctcattgatgtctggagagataagaaacctaaagacaagaatgcccagtac
gtctggaatcgcagtgacctgttgtctctccacctgatggaagtggacttcctcttaggc
ctcttcgagccaatggatatgatgtatgagctagacaggaacgtccagacagacccttcc
ctgacggagatggtgcaggtggccatcaaaatcctccagagaaacccccgaggattcttc
ctgctggtagaaggaggtaggatcgatcacggtcaccatgaggggaaagccaagcacgcg
ctgtatgagaccgtggagatggacagagccataggccaggctggtggcatgacgtcactg
gaggacacgctgaccgtagtcactgccgaccactcccatgtcttcacctttggtggatac
acaccccgtggcaatcccattttcggtctagcaccgatgcacagcgatgtggataaaatg
cccttcacctccatcctgtacggaaatggccccgggtacaaacttgtagctggagagagg
gagaatgtgtccgccgtggattatgctcatgccaactaccaggcccagtcggctgtgccc
ctgcgccaggagacccatgggggtgaggacgtagcaatctttgccaagggccccatggcc
cacctcctgcatggagtacacgaacagaactacatcccacacgtcatggcctatgccgcc
tgcattggccagaacacagaccactgccgttctggggcccaccacagcatggtggggcct
ctgcccttcctctctacccttacctcagtcatcctcctcaaattcttgttttaa

DBGET integrated database retrieval system