KEGG   Chelonia mydas (green sea turtle): 102944102Help
Entry
102944102         CDS       T02989                                 

Gene name
TGM6
Definition
transglutaminase 6
Orthology
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
Enzymes [BR:cmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102944102 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 699 aa AA seqDB search
MADLTPTQISWHPKANTSAHHTDRYAHTELIVRRGQVFTITLWFNRPWQTGDNLAFVTEI
GPAPSEAHHTKAIFNLSEVGASGWTAVQGPSESSYMNFSISSPANAVIGRYKLSLQITSG
NKVSSKFLGHFVLLFNPWCSGDDVHIANEDARQEYVLDENGIIFIGNANYIEARGWYYGQ
FQDGILNTCLTMLDLSLYCRQDPVTDAFHRGDPRYVGRVISSMINGNDNDNGVLEGSWDD
NFSEHENPSRWNGSVVILRKWRQENYKPVQYGQCWVFAGVMCTVLRCLGIPTRLISNFNS
AHDVDGNLSIDKYYDSAGKCLNISRDSSWDYHVWNEVWFIRRDLGTPYSGWQVLDSTPQE
QSKGIFQCGPASVRAIKEGDVDLDYDTLFVFTEVNADCNQWIVYKDGTKKKVYCDTERIG
KAISTKAMGSNSRVDVTNNYKYPEGSHEEREVYKKACAKARGSHLTERLSEAPNEGSSET
VRKPEVSGVFKLVEPPVFGKDINLILILTNLSSEYKPVKVNLSASTILYTRRAVAEILQA
ATSVDLGSKEEKQIQLKISYAQYEKSLTNDKKILVTALCEVMHTQEAKMLVEKTITLESP
TIFIKIPAQVVVHKPVTVEISYANPLPEPVKDCVVLVKLMNQEVKIDVAPLRPKERSKIY
LEFTPHRSGAMQLQVDFSCDKFAYVKGFETIDVALGQLQ
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcagatctcacgccaacacaaatcagctggcatcctaaagccaacactagcgcacac
catactgacagatatgcccacacagagctgattgtgaggagagggcaggtcttcactatc
accctgtggttcaacaggccatggcagacgggagacaacttagcattcgtcacagaaata
gggccagccccttcagaggcacatcacaccaaggccatctttaacctctctgaggtgggg
gccagtggctggactgcagttcaaggacccagtgagtccagctacatgaacttctcaata
tccagcccagctaatgcagtcattggacgttacaaactgagcctccagatcacctctggc
aacaaggtctcctccaagttcctggggcactttgtactgctctttaacccttggtgttca
ggtgatgatgtccacatagctaatgaagatgcaagacaggaatatgttctggatgaaaat
ggaatcatctttattggaaatgccaactatattgaagctagaggatggtactatgggcag
ttccaagatggcattctaaatacctgccttaccatgctggatctgagcctgtactgtcgt
caggacccagtcaccgatgcgttccacagaggagatcctagatatgtggggcgggtgatc
agttcaatgatcaacgggaatgataatgataacggggtgctggagggaagctgggatgac
aatttctctgagcatgaaaacccatccagatggaatggtagcgtggtgatcctcaggaag
tggcgtcaagaaaattacaagcctgtccagtacggccagtgctgggtttttgcaggcgtg
atgtgcacagtcctgagatgtttggggattccaactcgtttgatttcaaactttaattct
gcccatgatgtggatggaaacctgagtattgataaatactatgacagtgctggaaagtgc
cttaacatcagcagagactcctcatgggattatcatgtctggaacgaagtttggttcatt
cgaagagacttgggaacaccatacagtggatggcaggttctagattcaactccgcaagag
caaagcaaagggatatttcagtgcggtcctgcttctgtcagagccatcaaagaaggtgat
gtagacttggactatgacaccctatttgtgtttacggaggtaaatgctgactgcaaccaa
tggattgtctacaaagatggaaccaaaaaaaaagtgtattgtgacactgagagaattggc
aaggccatcagcaccaaagctatgggcagcaattcccgtgtggatgtcactaacaattat
aaatatccagaaggctctcacgaggaaagagaggtgtataaaaaggcctgtgccaaggca
cgtggatcacacctcacagaaagactctcagaagctcctaatgagggatcatcagaaaca
gttagaaaacctgaggtctctggggtattcaagctagttgaaccccctgtgtttggcaaa
gatatcaacctaatcttaattctcaccaacctgtcctctgaatataaacctgtaaaggtg
aacctgagtgcatcaaccatcctgtacacaaggagagcagtggcagagatcttgcaggca
gccacatctgttgatcttggttctaaagaagagaaacagattcagttaaagatctcttac
gcccagtatgaaaagtccctgactaatgataaaaagatcttagtgactgccttgtgtgaa
gtcatgcacacacaggaggcaaagatgttggtggagaagaccatcactttagagtctcca
accatcttcatcaagattcctgcacaggttgtggtgcacaagcctgttactgtagagatc
tcatatgcaaatcctctcccagagccagtgaaggactgtgtggtgctggtgaaactgatg
aatcaagaggtcaagatagatgtggcaccactgcgacccaaggagcgatcaaagatttac
ttagaattcacaccccacagaagcggtgcgatgcagctgcaggtggacttctcttgtgac
aagtttgcctatgttaagggatttgagaccatcgatgtggccctcggtcagttgcaatag

DBGET integrated database retrieval system