KEGG   Chelonia mydas (green sea turtle): 102947149Help
Entry
102947149         CDS       T02989                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102947149 (ABHD6)
Peptidases [BR:cmy01002]
 Serine Peptidases
  Family S33
   102947149 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 337 aa AA seqDB search
MDLDVLNMFVIAGGTLAIPILAFVASFLLWPSALIKIYYWYWRRALGMQVRYANYDDYRF
CFSYRGRPGFRPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDYS
INGQVKRIHQFVECIKLNRKPFHLIGNSMGGNVAGVYAAQYPAEICSLSLVCPAGLPYPT
DNKFLKRLRELKESERIERIPLIPSTPEEMADMLKLCSYVRFKVPQQILQGLVDVRIPHN
EFYRKLFLEITDEKSRHALHENMSKIKAPTQIIWGKQDQVLDVSGADVLAKSISDCQVHI
LENCGHSVIVERPRKTAKLVLEFLALVHNTENNKKLA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaccttgatgtgttaaacatgtttgtaatagcaggaggcactctggctatccccatt
ctggcatttgtagcatcctttctcctatggccttctgcactgatcaaaatctattattgg
tactggcgtcgagcactgggcatgcaggttagatatgctaactatgatgattaccggttc
tgtttttcttatcgagggagacctggattcagaccatccatactgatgttacatggattt
tcagcccacaaagatatgtggttgtctgtggtcaagttccttccgaagaacctgcacttg
gtttgtgttgacatgcctggtcatgagggcactacccgatcatcgttagatgactactcc
atcaatgggcaagttaaaagaatacaccagtttgttgaatgtatcaagctgaacagaaaa
ccttttcacctgatcggcaactcaatgggtggaaatgttgcaggagtttatgctgctcaa
tacccagcagagatttgcagcctgtctcttgtatgccctgcaggtctgccctatccaact
gataacaaatttcttaagcgtctgcgggagctgaaagagtctgaacgtattgaaaggatt
cctttaattccatcaacgcctgaggaaatggcagacatgctgaagctttgttcttatgtg
cgctttaaagtacctcagcagatcctgcagggccttgttgatgttcgcatcccgcataat
gaattttaccggaaattatttttagaaattacagatgaaaagtccagacatgctcttcat
gaaaacatgagcaagatcaaagccccaacgcagatcatctggggaaaacaagatcaggtt
ctggatgtttctggagcagatgttctagcaaaatctatttctgactgtcaggtgcatatt
ttggaaaactgtggacactctgtgatagtggagcggcccaggaaaacggcaaagctcgta
ctggaatttttggcattggtgcacaacacagagaacaataagaaactagcttga

DBGET integrated database retrieval system