KEGG   Chelonia mydas (green sea turtle): 102948272Help
Entry
102948272         CDS       T02989                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     102948272 (EEF2K)
Protein kinases [BR:cmy01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   102948272 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 710 aa AA seqDB search
MADEDLIFRMEGIDDARSTKAVSGNYPDADSEDEDSYYICPITDDPVSNKAANNKVANYY
SNLAKDEHYSSTSSPRNSFNFKEAWKHAIQKAKHMPDPWAEFHLEDIETEYATRYRYNAV
TGEWVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQNWRGAFNYVAKQYIETVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIVQTSIIEMKNRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQLIIVDIQGVGDLYTDPQIHTESGTDFGDGNLGVRGMALFFHSHA
CNKICRSMGLTPFDLSPKEKHVLDQSNKLLESAQTIVRGTEEKCGSSRVRTISGSRPPLL
FRLSENSGDESMSDVAFDSLPSSPSSATPHKMDMLHWPVFNEVDNLVHKDHDRLDNQRDS
ENGGDSGCPSEKRSDLEDMDHRERGPSNCNRRRESDEDSLGSSARVSVEKWNLYNSSRVH
VHRPSCVAVEVQRLNALELEKKIGKSILGKVHLAMVRYHEAGRFCAKDQEWDQESALFHL
VHAADCGELEAIVGLGLIYSQLPHHILSEVTSEDTEESRVKGFDYLLRAAEAGDRPSMIL
VARAYDTGVNLGSNRIQDWKEALHWYNAALNMTDYDEGGEYDGTQDEPRYLLLAREAEML
MTGGFHLAKDPQRSGELYTEAAEAAIQDMKGRLANQYYQKAEEAWAMMEE
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggaccttatctttcgtatggaaggtattgatgatgccaggtcaactaaa
gcggtctctggaaattatcctgatgctgatagtgaggatgaggatagttattacatctgc
ccgataacggatgatccagtatctaacaaggctgcaaacaacaaagtcgccaattattac
agcaacttagcaaaagatgaacattacagttctacctcttctcctagaaactcattcaat
tttaaggaagcctggaaacatgccattcagaaagctaaacacatgcctgatccctgggca
gaatttcatcttgaggacattgaaacagaatatgccacacgttataggtacaatgcagtt
actggggagtgggtcgaagatgaagttctcatcaaaatggcttcacaaccctttggccgt
ggagcaatgcgggagtgcttcagaacgaaaaagctgtccaattttttacacactcaaaac
tggagaggtgcatttaactatgttgccaagcaatacatcgagactgtagacagggatgta
tactttgaggatgtccgacttcaaatggaagcaaaactttggggagaggagtataaccgg
cacaagccaccaaaacaggttgacatagtgcagaccagcattatcgaaatgaaaaacaga
cctggaaagcccctcttccatttggaacattacatagagggcaaatacatcaaatacaac
tcaaactctggattcgtacgagatgacaatattcgccttaccccacaactcattattgtt
gatatccagggagttggcgatctttatacagaccctcagatccacacagaaagtggcaca
gactttggagacggcaacctaggtgtacggggtatggctttgttctttcattctcatgcc
tgtaacaagatttgcagaagtatgggacttacaccttttgatctttcacctaaagagaag
catgtcttggatcagagtaacaaactgcttgaatctgctcagacaattgtacgtggcaca
gaggaaaaatgtggcagtagccgggtgagaacaatctctggtagtcggcctcctctgctt
ttccgcctgtctgaaaattctggagatgagagcatgagtgatgtggcatttgactcctta
ccctcttctccctcctcagcaacaccacataagatggacatgcttcactggcctgtgttc
aatgaagtggataacttggttcacaaagaccatgaccgtcttgataaccaaagggactct
gaaaatggtggagacagtgggtgccccagtgaaaagagaagtgacctggaagatatggat
catcgagaaaggggcccttcaaactgcaaccgaagacgtgaatctgatgaagacagtttg
ggaagttctgcaagggtcagtgtggagaagtggaatctctacaattcttccagagtccac
gtccatagaccatcctgtgttgcagtggaagttcagagactcaatgcactggaacttgaa
aagaaaattgggaaatccatccttgggaaggtccatctggccatggttcgctaccatgaa
gctggacgtttctgtgcgaaggatcaggagtgggatcaggaatccgctctttttcatctg
gtgcatgctgctgattgtggagaactggaagccatcgttgggttaggactcatatattcc
cagctgccacatcacattctttcagaggtcacttcagaggacacagaggaaagccgagta
aaaggatttgattatttactgagagcagcagaagctggagaccggccttccatgattctg
gtagcaagagcatatgacacaggtgtaaatcttggttcaaacagaatccaagactggaag
gaagccctgcactggtacaatgctgcactgaacatgaccgattatgacgaaggaggtgaa
tatgatggaactcaggatgagcctcggtatctgctcctggcaagggaagctgagatgcta
atgacaggagggttccacctggccaaggatccacaaagatcaggagaattgtatacagaa
gcagcagaagcggcaatacaagacatgaagggcagattggcaaatcagtactaccagaaa
gctgaagaagcttgggcaatgatggaggaatga

DBGET integrated database retrieval system