KEGG   Cryptococcus neoformans B-3501A: CNBA0360Help
Entry
CNBA0360          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CNBA0360
Protein kinases [BR:cnb01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   CNBA0360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 388 aa AA seqDB search
MVLTKSGRHEDTGTVELVTFPKPRFKPELEGILNVPNSDRTKLAFPSSTPNPSLDPLMDE
GPVGSGLLVERHNQGNGNGNGNGNISGNGNGNGNGNGQRLRIPMERRYYSPPPATLVYPP
EVHEYNERFTHLLENIKKRHDPTVTTVAQGVLEWKRKRKTGRIGVPIQEWLDRFYMSRIG
IRFLIGQHVALNTLQPHPDYVGIICTRANVHDICHEAIENARYVCEEHYGLFKGPPIQLL
CPKDLTFPYVPGHLSHICFELLKNSLRAVVERFGVENEEAFPPIKVVVVEGREDITIKIS
DEGGGIPRSAIPMIWTYLYTTMSDEGLEATIEQSDFKAPMAGFGYGLPLARLYARFFGGD
LRLISMDGYGTDVYISLNKLSSSCEPLQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgacgaaatctgggagacatgaggacacggggacagttgagcttgtgacattt
ccaaaacctagattcaaaccagaacttgaaggtatacttaatgtcccaaattcagaccga
acaaaactagctttccccagctccactcctaacccttctctggacccacttatggacgaa
ggcccagtcggttccggtcttctggtcgagagacataaccagggaaacgggaacgggaat
gggaatgggaatataagcgggaatggaaatggcaacggaaacggcaacgggcagaggtta
cggatacccatggaacgtcggtactattcaccgccacctgcaactctcgtctacccaccg
gaagtacatgagtacaacgaaaggtttactcatttacttgagaatatcaagaaaagacac
gacccaactgtcactaccgttgctcaaggtgtattggagtggaagaggaagcgaaagacc
gggaggataggagtaccgattcaggagtggttggataggttctacatgagccgaattggt
attcgatttttgatagggcagcacgttgcgctcaacactttacaacctcatcctgattat
gtagggataatttgcactcgagccaacgtgcatgatatatgtcatgaagcaattgaaaac
gcccgatatgtctgtgaagagcattacggcctcttcaaaggcccgcctatccagcttctt
tgccctaaagacctcacatttccatatgtgcccgggcacctctcccacatctgctttgaa
ctcttgaaaaactcccttcgtgcggttgtagagcgttttggagtggagaacgaggaagct
ttccccccgatcaaggtagttgtagttgagggtagggaggatatcaccatcaagatttcg
gatgaaggtggggggattcccaggagtgcgattcccatgatctggacgtacctctatact
acaatgagtgacgaaggtttagaagcgaccattgaacagtcagatttcaaagcccccatg
gctggtttcggctacgggcttcccctcgcaaggctgtacgctagattctttggtggcgat
ctcagattgatctctatggacgggtacgggacggacgtgtatatttctctcaacaagttg
tcctctagttgtgaacctttgcaatag

DBGET integrated database retrieval system