KEGG   Cryptococcus neoformans B-3501A: CNBA0600Help
Entry
CNBA0600          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cnb04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 411 aa AA seqDB search
MRLSISISAALLAFTSLVSASNVVDLDSTNFDQIVGQDKGALVEFFAPWCGHCKNLAPTY
ERLADAFPTDKVVIAKTDADGVGRELGSRFGVSGFPTLKWFPAGSLEPIPYSGARDLETL
AAFVTKQSGVKSNIKPPPPPAYTELDASNFDEIALNESKNVLVAFTAPWCGHCKNMKPAY
EKVAKVFSSEPDVVIALMDADEAENKPVAQRYGVSSFPTIKFFPKGSKEPVAYDSGRTAE
QFVNWINEKSGTHRSVSGLLSETAGRVLTLDTLASEFFSANVPERSEIVKKAQEAVTTVD
EKSKATANYYIKAMERITAKGEEWLTKEQARLANLLASPSLAPTKLDELKVKINILSAFA
AQKAGEAYDSAEEVLEDAWDSAKQIPIQAKDGLDQFADAVEEKAKRVRSDL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcagtatctcaatctcagcggctcttctcgcttttacatctctggtgtctgcc
agtaacgtcgtggacctcgacagtaccaactttgaccagattgttggacaggacaagggt
gcccttgttgaattcttcgcaccatggtgtggtcattgcaagaacctcgcccctacgtat
gagcgtcttgccgatgctttcccgaccgacaaagttgtcatcgccaagactgatgctgat
ggtgtcggacgggagctcggttctcgattcggtgtctctggtttccccactctcaaatgg
ttccctgctggctcccttgaacccattccttacagcggtgctcgagacctcgaaaccctt
gctgcattcgtcaccaagcaatctggcgtcaagtccaacatcaagcctcctcctcctccc
gcttacactgaactcgatgcttccaactttgacgaaatcgcccttaacgagagcaaaaat
gtccttgtcgcgttcactgctccttggtgcggtcactgcaagaacatgaaacctgcctat
gaaaaggtcgctaaagtcttttcctctgagcccgacgttgtcatcgctttgatggatgcc
gacgaggctgagaacaagcccgtcgctcagcgttacggtgtctccagcttccccactatc
aagttcttccccaagggttccaaggaacctgtcgcttatgactctggtaggactgccgaa
cagtttgtcaactggatcaacgaaaagtctggcactcaccgatctgtttccggtctcctt
tccgagactgccggccgtgtcctcacccttgacacactcgcttccgagttcttctccgcc
aacgtccctgagcgctccgagattgttaagaaggcccaggaggctgtcactaccgtcgac
gaaaagagcaaggctactgccaattactatatcaaggctatggagcggattactgccaag
ggcgaagagtggttgaccaaggaacaggctcgacttgccaacctcctcgcttccccttct
ctcgctcctaccaagctcgacgagctcaaggtcaagatcaacatcctttccgctttcgcg
gcccaaaaggctggtgaggcttacgactctgccgaggaggttcttgaggacgcttgggac
tctgccaagcaaatccctatccaggcgaaggatggtctcgaccagtttgctgatgctgtt
gaggagaaagcgaagagggttaggtctgatctctaa

DBGET integrated database retrieval system