KEGG   Cryptococcus neoformans B-3501A: CNBA0860Help
Entry
CNBA0860          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CNBA0860
  Lipid metabolism
   00062 Fatty acid elongation
    CNBA0860
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CNBA0860
Lipid biosynthesis proteins [BR:cnb01004]
 Fatty acid synthase
  Component type
   CNBA0860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 328 aa AA seqDB search
MRLRFTFTLALLFSNWTLAAPASDQLVLSNSNAKPRPLVIWHGLGDTALSTGIENFINMT
QTIHPGIFVHSVQIPEGGRPDDERKAGFWGNAGEQGEEGCEQIKRIPELAEGFDGIGFSQ
GGLLLRHYIQYCNGPPVHNLITFGTPHYGISALIPCPTPPTLSCLLAARAARAGIYRPWA
QDHLVQAAYFRDTERLDEFYEVNEFLRDLNGERPFAERNSIEEINRRKGKRGEGKGLKGL
DNLVAIIFDEDRTVSPAQSSHFATYAPNNKTEIIPLHEQPLYKEDWIGLKGLDEKGGLRL
EHCPGEHMDLGGKRGCGESMVRKWVGWV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctacgctttactttcaccttggctttgctcttctccaattggacccttgcagct
ccagcttccgaccagctagtcctgtctaacagcaatgccaaacccaggcctcttgtaatc
tggcatggccttggagatacagctctctcaacaggtattgagaactttatcaacatgact
caaaccattcacccgggtatctttgttcattcggtgcagattcctgaaggtgggagacct
gatgatgaacgtaaggctggattttggggcaatgctggtgagcaaggtgaagaaggatgt
gagcagatcaaacggataccagagcttgcagaaggctttgacggaattggattttcacaa
ggtggtctcctcttgagacattatatccagtactgtaacggtcctccggtccataatctc
atcactttcggaacgccccactacggcatctccgctctcatcccgtgccctactcccccc
accctgtcatgtttgcttgcagctcgggcggcccgtgctggtatatatagaccctgggct
caagaccacttggtgcaggccgcctactttagggatacagaacggctggatgagttttat
gaagtaaatgaatttctaagggatctcaacggggaacgaccgttcgcagagcgcaacagc
atcgaagaaatcaaccgacgaaaaggcaagagaggagagggaaaaggcctaaaggggctg
gataaccttgtagctattattttcgatgaagataggacggtctcccccgcccagtcttcc
cactttgcaacctacgcacccaacaacaagactgaaattatccctcttcatgaacaacct
ctctacaaggaagattggattgggctcaaaggtctagacgaaaaaggtggattgcgacta
gagcattgtccaggagaacatatggatcttggcgggaaaaggggatgtggtgagagtatg
gttaggaaatgggttggttgggtctga

DBGET integrated database retrieval system