KEGG   Cryptococcus neoformans B-3501A: CNBA1620Help
Entry
CNBA1620          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cnb  Cryptococcus neoformans B-3501A
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 238 aa AA seqDB search
MSEAPSKWVPLEASPDVFNAWSEPLGLPQSLAFQDLFSLDPSFLSFIPAPHRAVLLLFPS
KGKLQEERSKEDRDDGKQFKGEGIWWIKQTIPNACGSIGLLHSLLNLPERGPDALSPDSK
LAQFKAESLPLTGLERAKLLDETTFFTEAHTSAASTGQSVVPTDLDVDEHFIAFVEGVDE
KGEKRIVELDGGRNGPLDRGASNNFLEDVAKVVQEKYFERAEGDVNFNMIVLAGKSDD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaccttctaaatgggtccctctggaggcttctccggatgtctttaacgcc
tggtctgaacctcttggtcttcctcaatccctcgcattccaagacctattctcacttgac
ccttcttttttgtccttcatcccagcccctcatcgagcggtgttactcctcttcccttca
aaaggaaaactacaagaagagagaagtaaggaagatcgagacgatggcaagcaatttaag
ggtgaaggaatttggtggatcaaacaaactattcctaatgcctgtggttctatcggtctc
cttcactctctactaaacttacctgagcgaggtccagacgctttgagccccgactcaaaa
cttgctcagttcaaggcagagtctttgcctttaacaggtctcgaaagggcaaagcttctg
gatgaaaccacctttttcactgaggctcacacaagtgccgcttcaacagggcagtctgtc
gttcccactgaccttgatgttgacgagcacttcattgcttttgttgaaggtgtcgacgag
aaaggggagaaacgtattgtagaacttgatggtggcagaaatgggccgcttgacagggga
gcatctaacaactttctcgaggatgtcgccaaggtagttcaagagaagtatttcgagaga
gcagagggagatgtcaacttcaacatgattgtactggcgggtaaatctgatgactga

DBGET integrated database retrieval system