KEGG   Cryptococcus neoformans B-3501A: CNBA1690Help
Entry
CNBA1690          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CNBA1690
Peptidases [BR:cnb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNBA1690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 708 aa AA seqDB search
MRKRRTTPRSNISKNANISKQLATTLPEGETQSTRKIQAASVEKQKPVIELLGAGKSTLA
SNDEDYLSPQVPPKPIISLEHPSSTTSTIKVATTFPHIVFDDLWIDILSFFAQVYLALYE
MTLGIGKWWAGTEIEDSHRGKETKEKEIKAKRRRRRVEPSSNSSDSATGRFFPGMVNLSG
TLCYMNSVLQSVASIPSLIIHLEKVIDLAVEVDIPTHVTDALLDVIRDLNTPNKRPPPAL
RPHNLLTALYPLPAIRRLLSTHEQQDAHELFLVLAEAVSDEVVKVAAEVAKVRGIGEIIS
LQGYLSGKNDGSDQPRRAGDMEGAKRRQRIRGVAQPWEGLLARRRVCQRCGWSEAIRMDT
LGGIELPVPLHGNTTLDACIMEYLAPEILSDVTCEMCSLKLTLDYYTSEVERLSGSPCKK
TSTKEENEPGSDNQVSASRKKKAREARRAETRLREMVNSNTVSDFGEPNLTPLPSSGLTA
QIPVKWLTAKTASTRQCVIVRPPQSLQLHFIRSEFTMYGTVQKKTAKVSFPLLLDLTRFV
SDGVWEERSGIKNMLASVSTEKTIPPITGQRVIYQLESAILHYGFTHSSGHFVSIRRKPS
PPLTKEEKSFRPLQVAKNCPDGCKCQDCVYFGQVRDLENTKVPGRGWLRISDADVEEVGE
EALHEAGGAVVMLFYERVMEYVAKKVVHDERLQGDGDSQDAGGLEDNI
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgacgcacgactcccagatcaaacatctcaaagaacgccaacatcagcaaa
caattggccactacactgcctgagggggaaacgcagtccacaagaaagatacaagctgca
agcgtcgagaagcaaaaaccggtaatagagttattaggcgccggcaaatccactcttgcc
tccaacgacgaggactacttatctcctcaagtaccacccaaacccattatctctttggaa
catccatcgtctacaacttcgactatcaaggtcgccactacctttccgcacatcgtgttt
gatgatctctggatagatattctatcattttttgctcaagtctatctcgcattatacgaa
atgactcttggaattggaaagtggtgggccggtactgagatagaagatagccataggggc
aaagagacaaaagaaaaagagatcaaggccaagaggcgtaggcgaagggtcgagccgtcg
agcaatagttctgattcggcaacaggccgattctttcctggcatggtaaatttaagtggg
acgctgtgttatatgaactctgttcttcagtctgtcgcctccataccctcactcatcatc
catctcgaaaaagttatcgatttggcggtagaagtggacataccgacccatgtcacagat
gctcttctcgatgttatccgggatctcaacactcccaataaacgccccccacctgctctt
cgaccacataaccttctcactgcactatatcctctccctgcgattcgacgactattgagt
actcatgagcagcaggacgcccatgaactatttctggtgctggctgaggcggtctctgat
gaagttgtcaaggttgctgccgaggttgccaaagtgcgaggcataggagaaattatctca
ctacagggatacttgtccggcaaaaatgatggaagtgaccaacctaggagagccggtgac
atggagggagccaaaagaaggcaaagaataagaggtgtggctcaaccatgggagggcttg
ttggcgagaagaagagtgtgtcaacgttgcggttggagtgaggctattaggatggatact
ctaggggggattgaattgcctgtcccgttacacggcaataccaccctcgacgcctgtata
atggagtacctcgcgcccgaaatactttccgatgtcacatgcgaaatgtgctctctcaag
ctcacactggattactacacttccgaagttgagcgattgtcgggctccccctgtaaaaag
acttctacgaaagaagagaatgagcccggtagtgacaatcaagttagtgctagtcggaaa
aagaaagctcgcgaagccaggcgcgcagagaccaggctacgagaaatggtcaattccaac
acagttagcgattttggcgaacctaatctaacgcccctaccgtcatccggcttgactgcg
caaataccggtcaaatggcttacggctaaaacagcgtccactcgacagtgtgtcatagtt
cgtcccccccaatctctccaactacatttcatccgctcggaattcaccatgtatgggacg
gtgcaaaagaagaccgcaaaagtctcatttccattgttattagatctcacaagatttgtc
tctgacggagtgtgggaagaaagaagcgggataaaaaatatgctcgcatcagtctcaacc
gaaaaaacgatccccccaataacaggacaaagggtaatataccaacttgagtcagctatt
cttcactacggatttacccactcttctggtcatttcgtcagtattcggcggaaaccctcc
ccgcctttgaccaaagaggaaaagtcattccgacccttgcaagtggcaaaaaattgtcct
gatgggtgtaaatgccaggattgtgtttactttgggcaggtgagggatctcgaaaatacg
aaagtaccaggcagaggatggctgcggattagcgatgcagatgtagaagaggtcggcgaa
gaggcacttcacgaagctggtggggccgtcgtcatgcttttctatgagcgtgtcatggag
tatgtagcaaaaaaagtcgtgcatgatgagcgacttcagggagacggtgacagccaagat
gctggaggtttagaagataacatttaa

DBGET integrated database retrieval system