KEGG   Cryptococcus neoformans B-3501A: CNBA2940Help
Entry
CNBA2940          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CNBA2940
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CNBA2940
   04113 Meiosis - yeast
    CNBA2940
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CNBA2940
Ubiquitin system [BR:cnb04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CNBA2940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 773 aa AA seqDB search
MNTHLAARLQHLASSYPPHTALFYARIWHTLAPTTDSNHDSLHALALAFLQAAEPYSAIH
LVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCCEKLGRYSEGQAVLARALKRGANI
SRFGCNVDEYPVLTLDRFSIACTLIECCNGISTPGQPVTQRKALDEDPWMWEAFTNLCDV
GRLKSFDVSLFQPIRELTKHSQGAPPPIESLFPAGAGLSLSRHASRSSRPPLSPNIHRQK
SPIEPAPGVLRLHQAQAGAGNSGGLFTPDVEGIGGKTGLGMMGNPSSWDSSSIIGDTTFA
VPEQPTKRPFPSFMSTATSFLPSSLRGGTSTPAGSDSPPKLPTMKRPRGKDPVKRPMETP
QSQMSSGLPLAKELRPNGAKYEDSDAPRRSSRLKTTTSKPAPKIPRDPHATRSRSVTSSN
SNNEVPSPPSLTSQDAILQREADEYLKDIVKKCARVYKSLSRYQCQQAIKEVDALPGELK
TSPWAMEILGRAFYEIANYAMARRAFTFLQQQEPYRIQSMEQLSTLLWHLTDLPALSHLS
QSLISISRSSPQAWIAVGNCFSLQKDHDEAMRCFRRATQVDEGCAYAWTLCGYEAVEMEE
YERAMAFYRTAIRTDARHYNAWYGMGLVYLKTDRPRYAEHHFRRAVEINPTNPVLLCCVG
MALEKSDDVVQALHFYERASKYAPTSAMVQFKRIRALVALQRYDEAISALVPLTHSAPDE
ANVFFLLGKCLLKKERRQEATVAFTNARELEPKLEGVINAVLAANGEEGEDEE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccacctcgcagcccgtcttcagcacctcgcatcctcctacccgccgcacaca
gccctcttctacgcccgcatatggcacacactcgcgcccaccacagacagcaaccacgac
tccctgcatgcgctcgcgctcgctttcctccaagcagcagagccatactccgccatacac
ctcgtcagagaccacacaggcctcgacaacctcgatctggatctggaaatcaggtttgag
aggacagacaaggtgtgtggcggctgtgccatgatcgttgctcgctgctgtgagaaacta
ggcaggtactcggagggacaggccgtcttggccagggcgttgaaaagaggtgccaatatc
agtaggtttggttgcaacgttgatgagtaccccgtcctgacacttgacagatttagcatt
gcctgcaccctcatcgaatgctgcaacggcatatctactcctggccaacctgtcacacaa
aggaaagcgcttgatgaggatccttggatgtgggaagcctttactaatctctgtgacgtc
ggtaggttgaagtcttttgatgtttctctctttcagccaattcgggaactaacgaagcac
tcgcaaggtgccccaccccctatcgagtccctcttccccgcaggagcgggcctttccctc
tctaggcacgcctcacgatcgtcaaggcccccattgtcgccaaacattcatcgccagaaa
tcccctatagaaccagcacctggcgttctgaggcttcaccaagcccaagcaggtgctggc
aatagtggtggattgtttacccccgacgtcgaaggaattggagggaaaacgggtcttggt
atgatgggcaatccttcttcttgggactcgtcatccataataggcgacaccacttttgcg
gtcccggaacaaccgaccaagagaccattcccgtcgttcatgtcaactgcgaccagcttc
cttccatcgtctcttcgaggtggtacatcgaccccagcaggaagtgactctccacctaaa
ttgcctactatgaaacgacccagaggcaaagatccagtcaaaaggccaatggaaacgccc
cagtcacagatgagcagcggactacctcttgccaaagaattgaggccaaacggcgcaaag
tacgaagactcggatgctccccgtcgtagctcgcggctcaaaacgacaacttctaaacct
gcacccaaaattccccgcgatccgcacgccacgcgctctcgatcagtcacttcctccaac
tccaataacgaggtcccttctcctccctcgctgacatcgcaagatgcgattctacaaagg
gaagcggatgagtatctcaaggatatagtaaaaaaatgcgcaagggtttacaaaagttta
agccggtatcagtgccaacaggccatcaaggaggtggatgccttgcccggagagttgaag
acatcaccatgggcaatggaaattctagggagggcgttttacgagattgccaactatgcc
atggcacggcgagcattcacgtttcttcaacagcaagaaccgtaccgcatccaatccatg
gagcagttatccacccttctctggcatctcaccgacctccctgcgctttcacacctttct
caaagcttgatctcaatcagtcgttcctctcctcaggcttggatcgccgtggggaattgc
ttcagcttgcaaaaagaccatgatgaggctatgagatgttttaggagagcgacacaagtg
gatgaaggttgcgcttatgcgtggacactgtgtgggtatgaagcggtagagatggaagag
tatgagagggctatggcgttctatcgaacggccatcagaacagacgcaagacattataat
gcttggtatgggatgggactagtatatctcaaaacggatagaccgcgatatgcggagcat
cactttagaagagccgtcgaaatcaacccgaccaatcccgtccttctatgttgtgttggc
atggcgctggaaaagtcagacgatgtcgtgcaagctcttcacttttatgagcgtgcctcc
aaatacgcgcccacctccgcgatggtgcagttcaaacgcattcgtgcccttgtcgctctt
caacggtacgacgaggccatttcagcgcttgtacccctcacacacagtgcaccggacgaa
gcaaatgtctttttcttgctgggaaaatgtttactcaagaaggagagaagacaagaagct
acagtggcatttacaaatgctcgggaactggaacccaaattggaaggcgtcatcaatgct
gttttggccgcaaacggagaagagggagaggacgaggaatga

DBGET integrated database retrieval system