KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA2940Help
Entry
CNBA2940          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb04111  Cell cycle - yeast
cnb04113  Meiosis - yeast
cnb04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CNBA2940
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CNBA2940
   04113 Meiosis - yeast
    CNBA2940
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CNBA2940
Ubiquitin system [BR:cnb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     CNBA2940
Chromosome and associated proteins [BR:cnb03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    CNBA2940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_19 TPR_8 ANAPC3 TPR_16 TPR_11 TPR_17 TPR_14 TPR_12 TPR_15 DUF1387 PknG_TPR TPR_9 Sec16_C
Motif
Other DBs
NCBI-GeneID: 4933548
NCBI-ProteinID: XP_778294
UniProt: Q560E6
Position
1
AA seq 773 aa AA seqDB search
MNTHLAARLQHLASSYPPHTALFYARIWHTLAPTTDSNHDSLHALALAFLQAAEPYSAIH
LVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCCEKLGRYSEGQAVLARALKRGANI
SRFGCNVDEYPVLTLDRFSIACTLIECCNGISTPGQPVTQRKALDEDPWMWEAFTNLCDV
GRLKSFDVSLFQPIRELTKHSQGAPPPIESLFPAGAGLSLSRHASRSSRPPLSPNIHRQK
SPIEPAPGVLRLHQAQAGAGNSGGLFTPDVEGIGGKTGLGMMGNPSSWDSSSIIGDTTFA
VPEQPTKRPFPSFMSTATSFLPSSLRGGTSTPAGSDSPPKLPTMKRPRGKDPVKRPMETP
QSQMSSGLPLAKELRPNGAKYEDSDAPRRSSRLKTTTSKPAPKIPRDPHATRSRSVTSSN
SNNEVPSPPSLTSQDAILQREADEYLKDIVKKCARVYKSLSRYQCQQAIKEVDALPGELK
TSPWAMEILGRAFYEIANYAMARRAFTFLQQQEPYRIQSMEQLSTLLWHLTDLPALSHLS
QSLISISRSSPQAWIAVGNCFSLQKDHDEAMRCFRRATQVDEGCAYAWTLCGYEAVEMEE
YERAMAFYRTAIRTDARHYNAWYGMGLVYLKTDRPRYAEHHFRRAVEINPTNPVLLCCVG
MALEKSDDVVQALHFYERASKYAPTSAMVQFKRIRALVALQRYDEAISALVPLTHSAPDE
ANVFFLLGKCLLKKERRQEATVAFTNARELEPKLEGVINAVLAANGEEGEDEE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccacctcgcagcccgtcttcagcacctcgcatcctcctacccgccgcacaca
gccctcttctacgcccgcatatggcacacactcgcgcccaccacagacagcaaccacgac
tccctgcatgcgctcgcgctcgctttcctccaagcagcagagccatactccgccatacac
ctcgtcagagaccacacaggcctcgacaacctcgatctggatctggaaatcaggtttgag
aggacagacaaggtgtgtggcggctgtgccatgatcgttgctcgctgctgtgagaaacta
ggcaggtactcggagggacaggccgtcttggccagggcgttgaaaagaggtgccaatatc
agtaggtttggttgcaacgttgatgagtaccccgtcctgacacttgacagatttagcatt
gcctgcaccctcatcgaatgctgcaacggcatatctactcctggccaacctgtcacacaa
aggaaagcgcttgatgaggatccttggatgtgggaagcctttactaatctctgtgacgtc
ggtaggttgaagtcttttgatgtttctctctttcagccaattcgggaactaacgaagcac
tcgcaaggtgccccaccccctatcgagtccctcttccccgcaggagcgggcctttccctc
tctaggcacgcctcacgatcgtcaaggcccccattgtcgccaaacattcatcgccagaaa
tcccctatagaaccagcacctggcgttctgaggcttcaccaagcccaagcaggtgctggc
aatagtggtggattgtttacccccgacgtcgaaggaattggagggaaaacgggtcttggt
atgatgggcaatccttcttcttgggactcgtcatccataataggcgacaccacttttgcg
gtcccggaacaaccgaccaagagaccattcccgtcgttcatgtcaactgcgaccagcttc
cttccatcgtctcttcgaggtggtacatcgaccccagcaggaagtgactctccacctaaa
ttgcctactatgaaacgacccagaggcaaagatccagtcaaaaggccaatggaaacgccc
cagtcacagatgagcagcggactacctcttgccaaagaattgaggccaaacggcgcaaag
tacgaagactcggatgctccccgtcgtagctcgcggctcaaaacgacaacttctaaacct
gcacccaaaattccccgcgatccgcacgccacgcgctctcgatcagtcacttcctccaac
tccaataacgaggtcccttctcctccctcgctgacatcgcaagatgcgattctacaaagg
gaagcggatgagtatctcaaggatatagtaaaaaaatgcgcaagggtttacaaaagttta
agccggtatcagtgccaacaggccatcaaggaggtggatgccttgcccggagagttgaag
acatcaccatgggcaatggaaattctagggagggcgttttacgagattgccaactatgcc
atggcacggcgagcattcacgtttcttcaacagcaagaaccgtaccgcatccaatccatg
gagcagttatccacccttctctggcatctcaccgacctccctgcgctttcacacctttct
caaagcttgatctcaatcagtcgttcctctcctcaggcttggatcgccgtggggaattgc
ttcagcttgcaaaaagaccatgatgaggctatgagatgttttaggagagcgacacaagtg
gatgaaggttgcgcttatgcgtggacactgtgtgggtatgaagcggtagagatggaagag
tatgagagggctatggcgttctatcgaacggccatcagaacagacgcaagacattataat
gcttggtatgggatgggactagtatatctcaaaacggatagaccgcgatatgcggagcat
cactttagaagagccgtcgaaatcaacccgaccaatcccgtccttctatgttgtgttggc
atggcgctggaaaagtcagacgatgtcgtgcaagctcttcacttttatgagcgtgcctcc
aaatacgcgcccacctccgcgatggtgcagttcaaacgcattcgtgcccttgtcgctctt
caacggtacgacgaggccatttcagcgcttgtacccctcacacacagtgcaccggacgaa
gcaaatgtctttttcttgctgggaaaatgtttactcaagaaggagagaagacaagaagct
acagtggcatttacaaatgctcgggaactggaacccaaattggaaggcgtcatcaatgct
gttttggccgcaaacggagaagagggagaggacgaggaatga

DBGET integrated database retrieval system