KEGG   Cryptococcus neoformans B-3501A: CNBA3110Help
Entry
CNBA3110          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cnb00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 357 aa AA seqDB search
MASQLPFTRLVQETQIGILSVLRACYLTKNVQDTLVTKDTLLKSDKSPVTVADLSAQSLI
SLHLLAHFQDPIIGEEDTSELRVNEPLRQRVVGLVNGGFEKEEGWGKDKTFSEDEILSAI
DAGSAKGGNKGRFWTIVFDGTSGFIRHQQYAVCLALIVDGVVELGVIGCPNLGPEPAKIG
EEIIPNGKGVLMVAVRGQGSWSRPLDSATYTKLNLPPTPPASNPLTFLESVESGHSAHSI
QARIGALLDVQRPSLRMDSQAKYTCLSRGEGGVYLRIPTKYVGGKIYEERIWDHAPGALL
IHESGGICTDMWGKELNFGVGRTLKENDGIVAAGKDIHPKAVEAVKKAIEEAQVENK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcaactccccttcacccgtcttgtccaagaaacacagatcggtatcctctct
gttctcagagcatgctatctcacaaagaacgtccaagacaccctcgtcacaaaggacact
cttctcaaatcagacaagtctccagtgacagttgccgacctttctgcccagtcgctcatc
tccctccacctcctcgctcactttcaagatccaatcattggcgaggaagacacgagtgag
ctgagagtgaacgagccgttgagacaaagggtggtcggccttgtcaatggagggtttgag
aaggaggagggatggggcaaagataaaactttttcagaggacgaaatcctgagtgctatc
gacgccggttctgctaaaggcggtaacaagggtagattctggaccattgtattcgacggg
acgtctggcttcattcgtcatcaacaatacgctgtatgccttgcactcattgttgatggc
gttgtcgaactcggagtcatcgggtgccctaaccttggccctgagcccgccaagattggt
gaggaaatcattcctaatggcaagggtgtcctcatggtagctgtgaggggtcaaggcagc
tggtctcgccctctcgattctgccacctataccaagctgaatcttccccctactccccct
gcctccaaccccctcacctttctcgagtccgtcgagtctggccactctgcgcattctatc
caggctcgaattggcgccctactcgacgttcaacgtccctccctccgtatggattctcag
gcgaaatatacctgtctctctcgaggtgaaggcggtgtctatcttcgtatccctacaaaa
tatgttggaggtaagatctacgaagagcggatctgggatcatgcccctggagccttgttg
attcacgagagtggtggtatctgtacagacatgtggggcaaggagctcaactttggtgtg
ggaaggactctcaaggagaatgacggcatcgtcgccgccggtaaagatattcatcccaag
gccgtcgaagcggtcaaaaaggcgattgaagaggcgcaggttgaaaacaagtga

DBGET integrated database retrieval system