KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA3110Help
Entry
CNBA3110          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00920  Sulfur metabolism
cnb01100  Metabolic pathways
cnb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CNBA3110
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CNBA3110
Transfer RNA biogenesis [BR:cnb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CNBA3110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 4933565
NCBI-ProteinID: XP_778311
UniProt: F5H931
Position
1
AA seq 357 aa AA seqDB search
MASQLPFTRLVQETQIGILSVLRACYLTKNVQDTLVTKDTLLKSDKSPVTVADLSAQSLI
SLHLLAHFQDPIIGEEDTSELRVNEPLRQRVVGLVNGGFEKEEGWGKDKTFSEDEILSAI
DAGSAKGGNKGRFWTIVFDGTSGFIRHQQYAVCLALIVDGVVELGVIGCPNLGPEPAKIG
EEIIPNGKGVLMVAVRGQGSWSRPLDSATYTKLNLPPTPPASNPLTFLESVESGHSAHSI
QARIGALLDVQRPSLRMDSQAKYTCLSRGEGGVYLRIPTKYVGGKIYEERIWDHAPGALL
IHESGGICTDMWGKELNFGVGRTLKENDGIVAAGKDIHPKAVEAVKKAIEEAQVENK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcaactccccttcacccgtcttgtccaagaaacacagatcggtatcctctct
gttctcagagcatgctatctcacaaagaacgtccaagacaccctcgtcacaaaggacact
cttctcaaatcagacaagtctccagtgacagttgccgacctttctgcccagtcgctcatc
tccctccacctcctcgctcactttcaagatccaatcattggcgaggaagacacgagtgag
ctgagagtgaacgagccgttgagacaaagggtggtcggccttgtcaatggagggtttgag
aaggaggagggatggggcaaagataaaactttttcagaggacgaaatcctgagtgctatc
gacgccggttctgctaaaggcggtaacaagggtagattctggaccattgtattcgacggg
acgtctggcttcattcgtcatcaacaatacgctgtatgccttgcactcattgttgatggc
gttgtcgaactcggagtcatcgggtgccctaaccttggccctgagcccgccaagattggt
gaggaaatcattcctaatggcaagggtgtcctcatggtagctgtgaggggtcaaggcagc
tggtctcgccctctcgattctgccacctataccaagctgaatcttccccctactccccct
gcctccaaccccctcacctttctcgagtccgtcgagtctggccactctgcgcattctatc
caggctcgaattggcgccctactcgacgttcaacgtccctccctccgtatggattctcag
gcgaaatatacctgtctctctcgaggtgaaggcggtgtctatcttcgtatccctacaaaa
tatgttggaggtaagatctacgaagagcggatctgggatcatgcccctggagccttgttg
attcacgagagtggtggtatctgtacagacatgtggggcaaggagctcaactttggtgtg
ggaaggactctcaaggagaatgacggcatcgtcgccgccggtaaagatattcatcccaag
gccgtcgaagcggtcaaaaaggcgattgaagaggcgcaggttgaaaacaagtga

DBGET integrated database retrieval system