KEGG   Cryptococcus neoformans B-3501A: CNBA3150Help
Entry
CNBA3150          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CNBA3150
Transcription machinery [BR:cnb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CNBA3150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 793 aa AA seqDB search
MAPKQRRATNSKAKATPTSVTSPPDQSSPVRSRGGSSSLSPIRSPQENSDLEDNNERHPG
TNGSGLKAEDEGSTDLLDRDGDLEEVHACPDSITFRYPSSVPDFTILSPREKAFKVARFL
HCTAPSCACTGLEPPAGRTIRITKHDSSNEDEDDEDEDDDVSMEDSENPLDFEDKKDEWR
TKEGWWRICGKCGHGWESGGHVWADDVPPKERTRRGKVVGRIEEILEDENKLVEFPTPQP
ESISSLLKQLHEFVPPPAGKTTISALPPPVDLSTPDDDTQEDNSDGERPRKRRRQASEST
HSDIEGEQHRGQGKKKQGKGPAKGAKPRVPRTVVRGAHGFIPMATDPDGNQHVEGHLPIS
AGGTGADETFEEEEEEEEELSTAKRPELDETERRRRTEIKVKEKEREEELVSRLAAGVNP
EDAGGAVEIWEGIELQKLPLRPAAIEQANREIMLPVVSSRNPTPVATILLVGLKNVFQRQ
LPKMPREYITRLVLDKNHISMAIVKRGYRVVGGICYRPFEARGFAEIVFCAVDSSEQIKG
YGSHLMNSLKDHVRKAHPTINVFLTYADNYAVGYFKKQGFTKEISYPRERWVGYIKDYEG
GTIMQGRMLPKVKYMEVHQMLADQKAAIIAKIKTLTKSHIIHPGLQIFKERQPDEEIKLT
KEQVPGLAESGWNPDLDDIVRQPKRNPYHVLLQHVLNDLQNEPSAWPFVKPVDSSVVADY
YDVIKDPMDLSTMEYKLENNHYESIEGFVADVKLMCANCRQYNGEKSTYTKQANLLEKAL
DRILKKRKSVLAD
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaaaacagcgtcgtgcaaccaactccaaagccaaagcgacaccgacatctgtc
acctctccgcccgatcaatcatcaccagtacgctcaagaggcgggtcatcatccctctcc
ccgatcaggtcaccgcaagaaaactccgacttggaggacaacaacgagcggcatccaggg
accaacggatctggattgaaggccgaagacgaagggtcgacagatttacttgatagagat
ggcgatttggaagaagttcatgcctgcccggacagtattacatttcgttatccttcgtcg
gttcccgattttaccatcctcagtccacgtgaaaaagctttcaaagtagcgaggttctta
cattgtacagcccctagttgtgcctgcactggccttgaacctcctgccggcagaacgatc
cgaataaccaaacatgattccagcaatgaggacgaagacgatgaggacgaggatgacgat
gtatctatggaggactctgaaaatccattggattttgaagataagaaagatgaatggagg
acgaaagaagggtggtggagaatatgcggaaagtgtggacacggttgggagagtgggggg
catgtctgggctgatgatgtccctccgaaagaaaggacaagaagaggcaaggttgttggg
aggatagaggaaatactcgaagatgaaaacaagctcgttgaattccccactcctcaaccc
gaatccatttcttccctgttgaaacaattgcacgaatttgtacccccgcctgccgggaaa
acgaccatttctgctcttcctcctcctgttgatctttctacccctgatgatgatacgcaa
gaagataatagtgacggcgaacgaccgcgaaagcgccgacggcaagcaagcgaatctact
cactctgatatcgaaggagaacagcaccgaggtcaggggaaaaagaaacaaggaaagggc
cctgcgaaaggcgctaaaccgagggtaccccgtactgtcgtccgaggggcgcatggtttt
attcctatggcgacggaccccgacggcaatcagcatgttgaaggacacctccccattagt
gccggaggtacaggggctgatgaaacctttgaagaggaggaggaggaagaggaggagctg
tcaacagctaaacggccagagctggatgagaccgagagaagaaggagaacagagattaaa
gtcaaggaaaaagaaagggaagaagagctagtcagcaggttggctgctggtgtcaatccg
gaggatgcaggaggggcagtcgaaatttgggaagggattgagctgcaaaagcttcctctt
cggccggccgcgattgaacaagcaaatcgagaaatcatgctacccgtcgtgtcctcccgc
aacccaaccccggtcgccaccattctactggttggcctcaagaatgtcttccaacgtcaa
cttccaaagatgcctagagaatacattacccgcctagtattggacaaaaatcatatcagt
atggcgatcgttaaacgagggtaccgggtagtaggtggaatctgctacaggccctttgag
gctcgagggtttgcggagattgttttttgtgccgtagacagttccgaacaaatcaagggt
tacgggtcacatctgatgaattcgctcaaagaccacgtccgaaaagcacacccaactatc
aatgtcttcctgacttatgcagataattatgctgtgggatattttaagaagcagggtttc
accaaagaaattagctatccgcgtgagcgctgggtcggttacatcaaagattacgaaggt
gggaccatcatgcaggggcgaatgctgccaaaagtcaagtatatggaggtccatcaaatg
ttagcggaccaaaaggctgccataatcgctaagatcaaaaccttgaccaaatcccatatc
attcacccgggtttacaaattttcaaggaacgtcaacctgatgaagaaatcaaactcacg
aaggagcaagttcctggattagctgaaagtggatggaatcccgatcttgatgatatcgtt
cgccaaccaaagcgaaatccataccatgttctccttcaacatgttctgaatgatctgcag
aatgagccttctgcatggccttttgtgaagcctgtggactcaagtgtagtggcggactac
tatgatgtaatcaaggaccctatggacctgtccaccatggaatacaaattagagaacaac
cattacgagtctattgaaggcttcgttgccgacgtgaagctcatgtgtgcaaattgccga
cagtataatggcgaaaagagcacctacaccaaacaagcaaacttgttggaaaaagctcta
gatagaatcttgaaaaaacggaaatcagttctggctgactga

DBGET integrated database retrieval system