KEGG   Cryptococcus neoformans B-3501A: CNBA3370Help
Entry
CNBA3370          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CNBA3370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 258 aa AA seqDB search
MGHHGARFSYNLFDDNRKQLSSFFESSLENTLWAVSRALCPSGYYITPDTFTKKVAPPYH
CCSCGHVVQSFRCRNGYLLAVGLAFYPPKEIGWQFVLGVAGWAIGFFGNVYHDEMLNDLR
RPPTKRIVMSHLPEDDASKLERYKVPRGGLFEWVSFPNYLCEWLEWTCWSFAANPYPFIS
VPALPYLLRAPEYRNSHTVLSIISNFYWPSWLLAPSWAFVLAEVTSMLPRAMRGHAWYKE
KFGNKYPKSRKAAIPGIL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggccatcatggagctcgtttctcctataacctttttgacgacaatcgtaaacagctc
tcatccttctttgaatcgtccctcgagaatactctctgggctgtatctcgcgcattatgc
ccatcgggctattatatcacccctgatactttcaccaaaaaggtcgcccctccatatcac
tgttgttcttgcggccatgttgttcaatcttttaggtgtaggaatggatatcttttagcc
gttggcttggctttctaccccccaaaagagatcggctggcaattcgttctcggtgttgct
ggatgggcaataggtttttttgggaatgtctaccatgacgaaatgctcaacgatctccgt
agaccgcctacaaaaagaatcgtgatgagccatcttccagaagatgacgcttccaaattg
gaaagatacaaagtgccgagaggtgggctctttgaatgggtctcatttccgaattacctg
tgtgaatggcttgaatggacctgctggtcttttgccgcaaacccatatccattcatctcc
gttccagccctgccctacttattacgcgcccccgaatataggaattctcatacggtgctg
tccattatatcaaacttttactggccctcctggctgctcgctccaagttgggcatttgtg
cttgcggaggtgacatctatgttgccaagagcaatgagaggacatgcttggtacaaggaa
aagttcggtaacaagtacccgaaaagtaggaaagcagctattccgggcatactttag

DBGET integrated database retrieval system