KEGG   Cryptococcus neoformans B-3501A: CNBA3450Help
Entry
CNBA3450          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CNBA3450
Enzymes [BR:cnb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CNBA3450
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNBA3450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 350 aa AA seqDB search
MSHQRTAHFQVPPLQISSVLHGGIHHPTLRTWQANGRNLTKSMLIYPIFISDDPDAEQEV
ATLPGQKRWGINKLEAFLKPLVEKGLKSVILFGVPVTMEKDPRGSAADDESTPVIQALKL
LTNVFPQLMLCVDVCLCEYTSHGHCGILSSLPNPAHSNAPTLDAEASAQRIAEVAVAYAK
AGAHCVAPSDMMDGRIRAIKYGLMQVGLANRCALMSYSAKFASGLYGPFRDAAGSAPSFG
NRKCYQLPPNARSLARRAIQRDASEGADILMVKPALPYLDIISDCAQYAPDHPTACYQVS
GEYAMVVAGAEKGIYDLREMAFETTESMVRAGASIILTYFTPQFLDWLDE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatcagcgcacagcccatttccaggtgccacctctccagatatcctccgtcctc
cacggcggtatccatcatcctactctcagaacatggcaggccaacgggcggaacctcaca
aagtctatgcttatctaccccatcttcatctccgacgaccctgacgctgaacaagaagtt
gcaactttaccagggcagaagcgatggggtatcaacaagctcgaagcgttcttgaagccc
ttggtggaaaaaggcttgaagagtgtgattcttttcggtgtgcctgttactatggaaaag
gatcctcgtggcagcgctgccgatgacgaatcgacccctgtcattcaagcgctgaaactc
cttaccaacgtcttcccccaactcatgctttgtgtcgatgtttgcctttgtgaatatacg
tctcacggtcactgtggcattctctcgtctctccccaatccagcccactccaacgccccc
actcttgacgcggaggcttcagctcagcgtatcgctgaagttgctgtcgcctatgccaaa
gctggtgcgcactgtgtggcaccaagtgacatgatggatgggagaatacgagcaatcaaa
tatggactgatgcaagtcggattggccaacaggtgcgctttgatgagctattcggccaag
tttgccagcgggttatacggacctttccgagatgccgccggaagcgccccttcgtttggc
aacagaaaatgctatcaactccctccgaatgctcgtagcctcgctagaagagctatccaa
cgagatgctagcgagggcgctgatatcctcatggtcaagcctgctctcccttacctcgac
atcatatcagactgtgcacaatatgcccctgatcatcccactgcctgctatcaagtctcg
ggtgaatatgccatggtcgtcgctggtgcagagaagggcatctatgatttgagggaaatg
gcgttcgaaactaccgaaagcatggttcgcgcaggagccagcataatcctgacatacttc
actcctcagttccttgactggcttgatgaatga

DBGET integrated database retrieval system