KEGG   Cryptococcus neoformans B-3501A: CNBA3620Help
Entry
CNBA3620          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNBA3620
Enzymes [BR:cnb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CNBA3620
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNBA3620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 682 aa AA seqDB search
MTAVSLSDGTAVLKTDPWLEPFSGALRERYAAYQKQRTIIEEHEGGLAEFSKGYKSMGFQ
IDKNGGVRYREWASNATEARLIGEFNNWSHTANPMTKSPFGVWECYVPPVSPGVCAIPHD
SMVKISMTLPGGESIDRIPTWITRVTQDLNISPIYDGRFWNPPKEQQYQFKHGHSTRPVE
GLKIYEAHVGISSPNMRVTTYKEFEVDVLPKIKQLGYNCIQMMAIMEHAYYASFGYQVTN
FFAASSRFGTPEELKSLVDKAHELGLTVLLDVVHSHASKNILDGINMYDGSDHLYFHEGG
RGRHDQWDSRLFNYGQHEVLRFLLSNLRFWMDIYMFDGFRFDGVTSMMYKHHGIGSGFSG
GYHEYFGDSVDLEAMVYLMLANAMLHETYPHVVTIAEDVSGMPTLCRPVAEGGVGFDYRL
SMAIPDMWIKLLKEYTDDQWEMGQIVHNLTNRRHLEKSVAYAESHDQALVGDKTLAFWLM
DKEMYDFMSDLSPLTPIIDRGLALHKMIRFIVHTLGGEAYLNFEGNEFGHPEWMDFPREG
NGNSFAHARRQFNLVDDKLLRYKYLYEFDVAMNWLEDKYKWLNSPQAYVSLKHEGDKMIV
FERAGLLFIFNFHPTQSFTDYRVGVDTAGEYKVILTSDETRFGGHNRIDMGGRYFTTPME
WNGRKNWLQVYSPSRTVLVLGL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgtttcgttatcagatggcacagccgtgttgaagactgatccttggttggaa
ccgttttctggcgccctccgtgaacgatatgccgcttatcaaaagcaacgtaccattatt
gaagagcacgaaggcggtctcgccgaattctcaaaaggctataaatctatgggcttccag
attgataaaaatgggggtgtaaggtatcgggaatgggcctctaacgcgacagaagcgaga
ctcattggcgaattcaacaactggtcccatacggccaatcctatgacaaagtctcctttc
ggtgtatgggaatgttacgtacctccagtttcacccggcgtctgcgccattccccatgat
tccatggtcaagatatcaatgacactcccaggaggtgaatctattgacaggattcctacc
tggattactcgagtcacccaagatcttaacatatctcctatatatgacggacgcttctgg
aacccgccaaaggagcaacagtaccaattcaaacatgggcattctactcggccggtagag
ggattgaaaatttacgaggcccacgtggggatttctagccccaatatgagagttaccaca
tacaaggagttcgaggtggatgtcctaccgaagataaaacagcttggctataattgtatt
cagatgatggctattatggagcacgcatactacgcctcattcggctatcaagtcaccaat
ttctttgctgcttcgtctcgcttcggtacaccggaagaactgaaatctctcgttgacaag
gcacacgaattgggtcttaccgtacttcttgatgtggttcattcccatgctagtaaaaac
attcttgatggtatcaatatgtatgatggttctgaccacctttacttccatgaaggtggc
agaggcagacatgatcaatgggattctcgcctcttcaattatggccaacatgaagtgctc
cgctttttgctttctaatctccgattctggatggacatatacatgtttgatggcttcagg
ttcgatggtgtcaccagtatgatgtacaaacatcatggtattggttcaggtttctcagga
ggatatcatgaatactttggggattcagtagaccttgaggccatggtatacctcatgctg
gcaaatgccatgctgcacgagacttatcctcatgttgtcaccatagcggaggacgtctcc
gggatgcccaccctttgccgtccagttgcagagggtggtgttggatttgattatcgactt
tccatggccatccctgacatgtggatcaagcttctcaaagaatacaccgatgatcaatgg
gagatgggccagattgtccacaacctcactaatcgaaggcacttggagaaaagtgttgca
tacgctgaaagtcatgatcaggctttggttggagacaagactttagccttctggttgatg
gataaggagatgtatgactttatgtctgatctttcccctttgactcccattatcgacagg
ggcttagctcttcataaaatgataagattcattgtccatacacttggaggagaggcgtat
ctcaattttgaagggaatgagtttggacaccctgaatggatggatttcccacgagaaggc
aatggcaactcctttgcccatgctcgtcgccagttcaaccttgtggatgacaagttgttg
cgttacaaatatctgtatgagtttgatgtcgctatgaactggctggaggacaaatacaag
tggctcaactcccctcaagcttatgtttctctcaaacatgaaggagacaagatgattgtg
tttgagagagccggactgctattcattttcaatttccatcccacacaatcattcacggac
tatcgagttggtgtagatactgcaggagagtacaaggtcatcttaacaagtgatgagact
agattcggcggacacaatcgcattgatatgggtgggaggtatttcacgacacccatggaa
tggaatgggcggaagaattggcttcaagtctattcgccttcgaggactgtactcgttctt
gggctttaa

DBGET integrated database retrieval system