KEGG   Cryptococcus neoformans B-3501A: CNBA3650Help
Entry
CNBA3650          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:cnb04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 516 aa AA seqDB search
MFQKVSDKFHRKQQSTTLPGKTQQVPNPTSPVLAKANSQAQQAYSLPQDHSPMEGIQRDS
PPIQQPMATEKAPIVGSSASTSLPTLSVQDGTLPLTPGAQGMQTGTIDGHRQLQSPVSRS
SSAGEDKMREKARDAQEQAAQAQANLHHATQQARVAAINAAATQAALETAAQLPATARVP
VSGGGVEQGQARRKTAGRYALSDFLIERTLGTGSFGRVHLVRSRHNGRFYAVKVLNKEKV
IKMKQVEHTNSEREMLVRVRHPFLVNLWGTFQDVNNLYMVMDFVAGGELFSLLRKSQRFP
NSVAKFYAAEVALALDYLHSLDIIYRDLKPENLLLGADGHVKVTDFGFAKYVPDITWTLC
GTPDYLAPEVVQSKGYNKSVDWYALGVLIFEMLAGYPPFFTEDGNPMKLYEKIIAGKVRY
PTYFDALAKELLKNLLIGDLTKRYGNLRAGSSDIFAHGWFAEVDWDKLYRREIPAPYVPK
IDGEGDASQFDRYQEADVSAYGKVGNGPYDHFFTEF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaaaggtgtccgataagttccatcgcaaacagcagtccacgacattacccggt
aaaacgcaacaggttcctaaccctaccagtccagtcctggcgaaagccaattctcaagct
caacaagcatattctttgcctcaagatcattccccgatggaaggtatacaaagggattcc
ccccctatccaacagcctatggctactgaaaaggcacccatagttggatcttctgcatcg
acgtctttacccaccctatccgtgcaagatggcactcttccattgactccaggtgctcag
gggatgcagacaggcacaattgacgggcatcggcaacttcagagtcctgtgtctcgtagt
agtagtgcaggcgaggataagatgagagaaaaggcgagggatgcccaggagcaggcagcg
caagcccaggccaacctccatcacgcaacgcaacaagcgcgcgttgccgccatcaatgcc
gccgctactcaagctgcccttgaaacagccgcccagctgcccgcaactgctagggtccca
gtttccggtgggggagttgagcagggtcaagcaagacgcaaaacagctggccgatatgct
ctatctgatttccttattgaaagaactttgggcaccgggtccttcggacgtgtgcattta
gtgcggtcacgccacaacggtcgcttctatgccgttaaggttctgaacaaggagaaggtt
atcaagatgaagcaagttgaacacaccaattctgaacgagagatgttggtgcgggttcga
cacccatttctcgtcaacctctggggaacctttcaggatgtgaataacctgtatatggtc
atggactttgtggcaggaggtgaactctttagccttcttcgtaaaagtcaacgattcccg
aattctgtcgcgaaattctacgcggccgaagttgctttagcgctcgactatcttcattca
ctcgatattatctaccgagatcttaagccagaaaatctacttttgggtgcagatggccat
gtcaaggttaccgactttggttttgccaagtatgtacctgatatcacctggactctttgc
gggacaccggattaccttgctccggaggttgttcagtccaagggttataacaaaagcgtc
gattggtacgctttaggggtattaatatttgaaatgctggcgggttatcctcccttcttc
accgaagacggcaatccaatgaaattgtatgagaagatcattgctggcaaagtccgctat
ccgacatactttgacgcacttgcgaaagaactcttaaaaaatctactgatcggggacctc
actaagcgatacggtaatttgagagcgggctcttctgatatatttgcccatgggtggttc
gcagaagtcgactgggacaagctgtacaggcgcgaaatcccggctccatatgtgcccaag
attgacggcgaaggagacgctagccagttcgatcgctaccaagaggcggatgttagtgct
tatgggaaggttggcaacggtccatatgatcatttcttcacggagttttag

DBGET integrated database retrieval system