KEGG   Cryptococcus neoformans B-3501A: CNBA5480Help
Entry
CNBA5480          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Exosome [BR:cnb04147]
 Exosomal proteins
  Proteins found in most exosomes
   CNBA5480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 127 aa AA seqDB search
MSWQAYVDDHLVATGKVKKAAILGKQGGVWAASAGYNLSQQEQNAVTQTYFQQPDSVRAN
GITLNGFKFMCIQATPEEVIGRKGERGVFVIPTNQAILVAEYDAPTSAGEANVVVAKLAD
WLKSASY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcgtacgttgacgaccatctcgtggccaccggaaaagtcaagaaagcc
gccatcctgggtaaacagggtggtgtttgggccgcaagcgctggctataacctctcccag
caagaacagaacgccgtcacccagacatattttcagcaacccgacagtgtccgagccaac
ggcatcacccttaacgggtttaagtttatgtgtattcaggcaactcctgaggaagttatc
ggtcgtaaaggtgaacgaggggttttcgtgatccctaccaatcaggctatccttgtcgct
gagtacgacgctccgacctccgcgggcgaggccaatgtcgtggttgccaaacttgccgac
tggctcaagagcgcgagctactaa

DBGET integrated database retrieval system