KEGG   Cryptococcus neoformans B-3501A: CNBA5810Help
Entry
CNBA5810          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cnb00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cnb00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 2333 aa AA seqDB search
MSIPTPPAFQGVVPPSDIPATQQASSLAPAAHSAVAPEADTPTMERTPSSAPVPRPAGSL
YPPATLKGIDYQGMPDEPKWDDSMGEPDAVLELADGLALAGHSFGAKKSVAGECVFQTGM
VGYPESLTDPSYSSQILILTYPLVGNYGVPERPDVETSHVPTSEDAHNVPPASSLLDSLP
LEFESSHIHVAALVVANYHPSFSHHLATSSLGKWLEEQGIPAIWGVDTRMLTKRLREGGV
LLGRVLNKRAGVLDGERGRDGQSGVLGGVQRLINGLSPSTSMAQTQSIDKFNVSWREDFE
TIPYYDPNHENLVAKVSTKAPVVYTASTSSDKKIHPQTGRQMRVVAIDVGMKWNQIRCFR
ERGIEVKVVPWNYDINNESEPYDGLFVSNGPGDPSMVKETISNLSQALETSKVPIFGICL
GHQLLALASGAKTRKMKYGNRGMNIPCTCATSGRCYITSQNHGYEVDVTTLKNGWEPLFT
NANDGSNEGIWCGKNGKPFFSVQFHPESAPGPRDTEFLFDVFIQSIVDTAREGRLISIDV
PGGELATNIAAKPREQVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILVNPN
IATIQTSKGLADKVYFLPVTPEFVLKIIKHEKPDGIYCTFGGQTALNVGIKLKDEFSKLG
VKVLGTPIETIITTEDREMFARAMEEIGEKCAESATAVNLTEAIEAANRIGFPVIVRAAY
ALGGLGSGFAKDVEQLTELCGKAFATSPQVLVEKSMKGWKEIEYEVVRDCRNNCITVCNM
ENFDPLGIHTGDSIVVAPSQTLSDADYNMLRTTAVNVIRHLGVVGECNIQYALNPYSKEY
CIIEVNARLSRSSALASKATGYPLAFIAAKLGLNIPLNEIRNSVTKLTSACFEPSLDYCV
VKIPRWDLKKFNRVSTALSSSMKSVGEVMAIGRTFEETIQKAIRCIDDQLPGFGDHAKVE
DLDYEIANPTDKRLFAIAAALKKGYSVEKLNEMSSIDPWFLTRLQRLIKTEQVISQYNAS
NVPSALVLNAKQLGFADRQIAKMLSSNELAVRRLRIEAGITPFVKQIDTVAAEFPAFTNY
LYTTYNATEHDVDFEDNGVMVLGSGVYRIGSSVEFDWCAVRAIRTLRENGMKTVMINYNP
ETVSTDYDEADKLYFENISLETVLDIYDTEHSSGVVLSMGGQTPNNIALALHRQNVKIYG
TSPEMIDTAENRYKFSRMLDKIGVDQPLWRELTSFPEAKAFCDKVGYPVLVRPSYVLSGA
AMNVVFSQDDLNNYLTQATDVSRDHPVVISKYIEEAKEIEMDAVARDGKMVMHYISEHVE
NAGVHSGDATLVLPPQDLDAETVRKIEIATQKIGHALNVTGPYNIQFIAKNNEIKVIECN
LRAARSFPFVSKVTGIDAIEIATKVMLGLPVTPYPDVKMPANYVGVKVPQFSFSRLSGAD
PVLGVEMASTGEVACFGKDRYDAYLKALISTGIVPPKKNILLSIGSFKEKLEMLPSVHKL
HRMGYNLFATAGTADFIQEHGIPVKYLEQLGSENDLNPQKKEYSLSQHLANNLIDLYINL
PSKNRFRRPASYISQGYKSRRMAVDFAIPLITNVKNAKLFIEAIIRKPTFDISSVDYQTS
HETFTFPGLVSVQAFVPGAAEESSTDFGEATEAAIEGGFTIMQMVPQGVNSAVEDEISLQ
RAQANASGAAHCDYSFSVAATADNASRLQDAIAAGAKALYIPFNNFYGANNKVSSVSQHF
AAWPADRPIITDARATDLASTLLLASLNNRSIHITSVSTKDDLLLIALAKEKGLAVTCDV
SIYSLFYCQTDFPDAAKVLPSKADQEALWDNLASIDVFSVGVLPYELGRALNKPVSARSG
VAESLPLLLTAVTEGKLTLEDISLRLSENPRAIFGLPEQSQTYVEIEVNRRSSFTAEDAE
RTWSPLDGQAIAGNVHRVVANNHSIFLDGQSFSMPFGRDISASGSRPTKQARGSFALQKR
PSVTALMSPISEKTSSAGAKLMSLASVAPIRELSPIRGLVSVQTHPTFSRRHILSVKQFD
REDLHALFNVASEMRTAVERSGSVDTLRGRVLCTLFYEPSTRTSTSFEAAMKRCGGEVVQ
VNASTSSVQKGESLADTIRTVGCYADAIALRHPSVGSAKAAAKSSPVPILNAGDGIGEHP
TQSLLDVFCIREELGSVNGITVTLIGDLKNGRTVHSLVKLLSLYDVTLNFVSPRSLAMPE
SVKTEAFRAGIRFTESFTLTDEIVSRSDVLYVTRVQKERFENIAEYEAVKDIYVINNDVL
EKAKESAIVMHPLPRVNEIDPEVDFDSKRAAYFRQMRYGLFVRMALLTLVMGA
NT seq 7002 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccccacccctcctgcgttccagggtgtcgttcctcccagcgacatcccagcc
acccagcaggcttccagcttggctcctgctgctcacagcgctgtggcgcccgaagctgac
actcccaccatggagcgcactccttcctctgcccccgtacctaggcccgcgggcagcctt
tacccccctgctactctcaagggtattgactaccaaggtatgcctgacgagcccaaatgg
gacgactcgatgggcgagcctgatgccgtccttgagcttgctgatggcctcgctctcgct
ggtcactctttcggtgccaaaaagtctgttgccggagaatgcgtcttccagaccggtatg
gtcggttatcccgagtctctcaccgatccttcatactcttctcagatccttatcctcacc
taccccctggtcggtaactatggtgttcctgagagacccgacgtggagacctctcacgtc
cccacttccgaggatgctcacaatgttcctcccgcttctagccttcttgactccttgcct
cttgagtttgagtcttcccacattcacgttgcggcccttgtggttgccaactatcaccct
agcttctcgcaccacttggccacttcttccttgggcaagtggctcgaagagcaaggcatc
cccgccatttggggtgtcgacactaggatgctcaccaagcgtctccgagaaggtggtgtc
ctcctcggtcgagttctcaacaagcgagcaggtgtcctcgatggcgagcgaggtagggat
ggccagtctggcgtccttggcggcgttcagcgtctcattaacggcctttctccttcgacc
tctatggctcaaacccagtccattgacaagttcaatgtcagctggcgagaggactttgag
accattccttattacgatcccaaccacgagaatcttgtagccaaggtgtctaccaaggct
cctgttgtctacaccgctagcaccagctccgacaagaaaatacaccctcagacaggtagg
cagatgagggttgtggccattgatgtcggtatgaagtggaaccaaatcaggtgtttcagg
gagcgtggtatcgaagttaaggttgtcccttggaattatgatatcaacaacgaatctgag
ccttacgatggtctctttgtttctaacggtcctggtgacccttccatggtcaaggagact
atcagcaacctttctcaagccctcgagacttccaaggtccctatctttggtatttgtctt
ggtcaccaacttctcgcccttgcttccggtgccaagacccgcaagatgaagtacggtaat
cgtggtatgaacattccttgtacctgcgctacatctggtcgatgctacattacctctcag
aaccacggttacgaagtcgacgtaaccaccctcaagaacggctgggaacctttgttcacc
aatgccaacgacggctctaacgagggtatctggtgcggtaagaacggtaaacccttcttc
tccgttcagttccaccccgagtctgctcctggtcctcgagacactgagttccttttcgat
gtcttcatccaaagcatcgttgacactgctcgagagggcagattgatctccattgatgtt
cccggtggtgagcttgcgaccaacatcgctgccaagccccgagagcaggtcaagaaggtt
cttgtccttggttccggtggtctttccattggacaggccggtgaattcgactactccggt
tcccaagccatcaaggctttgaaggaggaaggtatctacaccatcctcgtcaaccccaat
attgccactatccaaacctccaagggtctcgcggacaaggtttacttccttcccgtcacc
cccgaatttgtgctcaaaatcatcaagcacgagaagcccgatggtatctactgtactttc
ggtggtcagaccgccttgaatgtcggtatcaagctcaaggacgagtttagcaaactcggt
gtcaaggtactcggtacccccattgagaccatcatcaccaccgaagaccgagaaatgttt
gcccgtgctatggaggagattggcgagaagtgtgccgagtctgctaccgcggtcaacttg
acagaggctatcgaagctgccaatcgaattggtttccccgtcattgttcgagctgcctat
gctctcggtggtttgggttctggtttcgccaaggatgtggagcaattgacagagctgtgt
ggcaaggcctttgctactagtcctcaagttttggttgagaagagtatgaagggttggaag
gagattgagtatgaagttgttagggactgcaggaacaattgtatcaccgtgtgtaacatg
gagaactttgatcctcttggtattcacactggtgactcgatcgtcgtcgccccctcccaa
actctctctgatgcggactacaacatgcttcgaactaccgctgtcaacgttatccgacac
ctcggtgtcgttggagagtgtaacatccagtatgcgctcaacccgtactccaaggagtac
tgcatcattgaagtcaacgcccgtctctcccgttcgtccgctttggcttccaaagctacc
ggttaccctcttgccttcattgctgccaagttgggtttgaacattcctttgaacgagatc
cgaaactcggtgaccaagttaacttcagcgtgctttgagccttctcttgactactgtgtc
gtcaagattcctcgatgggatctcaagaagttcaaccgcgtgagcaccgcgttgagctcc
tccatgaagtctgttggtgaagtcatggccatcggccgtactttcgaagagaccatccaa
aaggctatcaggtgtatcgacgaccagctccctggtttcggtgaccacgccaaggttgag
gatctcgactatgagattgccaaccctaccgacaagaggttgttcgccatcgcagcggca
ttgaagaagggctactctgttgagaagttgaacgagatgagctctatcgatccctggttc
ttgaccaggttgcagaggttgattaagacggagcaggttatctctcaatacaacgcttcc
aacgttccttccgccctcgttcttaacgctaagcagcttggtttcgctgacaggcagatc
gccaagatgctcagctccaacgagcttgctgttcgtcgtctccgtattgaggctggtatc
actccttttgtcaagcagattgacactgtcgccgctgagttccccgcgttcaccaactac
ctctacactacttacaacgccactgagcatgatgttgacttcgaagacaacggtgttatg
gtcctcggttctggtgtctaccgaatcggttcttctgttgaattcgattggtgtgctgtg
agggccatcagaacattgagggagaatggcatgaagacagtcatgatcaactacaatcct
gaaactgtgtctaccgattacgacgaggcagacaagttgtactttgagaacatctctctt
gagaccgttcttgacatctatgacactgagcactctagcggtgtcgttttgtccatgggt
ggtcagacccctaacaacattgcgctcgcgcttcatcgacagaacgtcaagatctacggc
acttcccccgagatgatcgacactgccgagaaccgatacaaattctctcgaatgctcgac
aaaattggtgttgaccaacccttgtggagggagttgacctcgttccctgaggccaaggct
ttctgtgacaaggtcggctaccccgtgcttgtccgtccatcttacgttttgtctggtgcg
gcgatgaatgtcgttttctcccaagatgacctcaacaactaccttactcaggctaccgac
gtttcccgagaccaccccgtcgttatctccaagtacatcgaggaggccaaggaaattgag
atggacgccgtcgccagggatggtaagatggtgatgcactacatctccgagcacgtcgag
aacgctggtgttcactctggtgatgctacgctcgtgcttccccctcaggacctcgatgcc
gagactgtccgaaagattgagattgccacacaaaagattggtcacgcgctcaacgttacc
ggtccttacaatatccaattcattgccaagaacaatgagatcaaggttattgagtgtaac
ctccgtgccgctcgatccttccccttcgtctccaaggtcaccggtatcgacgccatcgaa
attgccaccaaggtcatgctcggtttgcctgtcaccccctaccctgacgtcaagatgccc
gccaactacgtcggtgtcaaggtcccccagttctctttcagccgattgtctggtgcggac
cctgttctcggtgttgagatggcttctactggtgaagtcgcttgtttcggtaaagacaga
tacgatgcctacttgaaggctcttatctccaccggtatcgtccctcccaagaagaacatc
ctcttgtccattggttccttcaaggagaagcttgagatgcttccttccgttcacaagctc
caccgaatgggctacaacttgtttgctaccgccggtactgccgatttcattcaagaacac
ggtatcccggtcaagtacctcgaacaacttggctcggagaacgatctcaaccctcagaag
aaggagtactctttgagccagcatcttgccaacaacttgatcgacttgtacattaacttg
ccttccaagaacaggttccgacgaccggccagttacatctcccagggttacaagtctaga
cgaatggctgtcgactttgctattcctctgattaccaacgtcaagaatgccaagttgttc
atcgaggcaatcatccgaaagcccacattcgacatctccagcgtcgattaccaaacctct
cacgagactttcaccttccctggtctcgtctccgttcaggcctttgttcctggtgctgct
gaggagagctctaccgactttggtgaggcgactgaggctgcgattgagggtggatttacc
atcatgcagatggtgcctcagggtgtcaactctgctgtcgaagatgaaatctctcttcag
cgagcccaggctaacgcttctggcgctgcccactgcgactattccttctctgtcgctgct
actgccgacaatgcctctcgtttgcaggatgccatcgccgccggcgccaaggctctttac
attcccttcaacaacttttatggtgcaaacaacaaggtcagcagcgtctctcaacacttt
gctgcctggcctgccgacaggcccatcatcactgatgctagggctactgatcttgcttcc
accttgttgttggccagcttgaacaacaggagcatccacattaccagtgtttccaccaag
gacgacttgttgttgatcgcgttagctaaggagaagggtctcgccgttacttgcgacgtt
tccatctactctctcttctactgtcagactgacttccccgacgctgccaaggtccttccc
tctaaggcggatcaggaggctttgtgggacaaccttgcctccatcgacgttttctccgtc
ggtgttcttccttacgagctcggccgagccctcaacaagcccgtttctgcccgatctggt
gttgccgagtctctccctctcttgctcactgccgtcaccgagggaaagcttactctcgaa
gacatctctcttcgactgagcgagaatcctcgtgctatcttcggcttgcccgagcagtcc
cagacttatgtcgagattgaagtgaaccgacgatcctcttttactgctgaggatgccgag
cgtacttggtcacctctcgacggccaggccatcgctggtaacgttcaccgagtcgtcgcc
aacaaccactccattttccttgatggccaaagcttctcgatgcccttcggccgggacatc
tctgcctccggttctcgaccgaccaagcaagcccgtggctcgtttgctcttcagaagcga
ccttccgtcaccgccctcatgtcccccatctccgagaagacctcatctgccggtgccaag
ctcatgtcacttgcttccgtcgcccctattcgagaactttcccctattcgtggcctcgtg
tctgtccagacccatcccactttctcgcgtcgacacatcctctcagtgaagcaattcgac
cgtgaagacttgcacgcgttgttcaatgttgcttccgagatgcgtactgcggttgaacga
tcaggctctgttgacactcttcgaggcagggtcctctgcaccttgttctacgagccgtca
acgaggactagcacttcgttcgaggctgctatgaagaggtgtggtggtgaagttgtccag
gtcaatgcttctacttcttctgtgcagaagggtgagagcttggcagacaccatcaggact
gttggctgctacgccgatgccattgctttgcgacatccctctgtgggtagcgccaaggct
gcggccaagtccagccctgtgcccatcttgaacgctggtgacggtattggagagcaccct
actcagagtttgttggatgtcttttgtatccgagaagagttgggctctgtgaacggtatc
acggtcacactgattggtgatctcaagaatggtcgaactgttcactcgcttgtcaagctt
ctctccctttacgacgtgaccctcaactttgtctcccctcgttctcttgccatgcccgag
tctgtcaagaccgaggctttccgagccggtatccgattcaccgagtctttcactctcact
gatgagattgtgtccagatctgacgtcttgtacgttactcgagtgcagaaagagcgattt
gagaacattgcagagtacgaagctgtcaaggacatttatgtcatcaacaatgatgtgctg
gagaaggccaaggagtcggcgattgtaatgcaccccttgcctagggtgaacgagattgac
cccgaagtggactttgactccaagagggcagcgtactttaggcagatgcgatacggtctt
ttcgtccggatggctcttcttactcttgtcatgggtgcttag

DBGET integrated database retrieval system