KEGG   Cryptococcus neoformans B-3501A: CNBA6430Help
Entry
CNBA6430          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cnb  Cryptococcus neoformans B-3501A
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 738 aa AA seqDB search
MSTSSHLAHATHLPRPADSLPRSPYPHDAQHSPLPPPSFLHAFPLPPRASISSVAAPPAS
APLHSAPPYSSAQTLRASLPLPHPYYPLPLPHTPSGHRVLRSPNPPCLWPLPHPLPAIDS
LRRPSRHPPHPASHSGSPSLDHPRAYYDPTVSVPLAYRESYPSHPSTHPSSPYLPPPTPS
AYGYRAPSPFRIPPPLTFRYSRSPPPLDTMPPRKKAEPSTADTVAASNASATTGAPASAS
TRARRGANGKGWTTEHTYEPNGQRKEVIVIDDSASPMVQPVRKRTRAQVAAEQAAQQQQL
HQAYASTNAGYSDTVSISNGHGSVASTAGTAAGGTTKKRKLEEDQGKKAKAKVASTATSA
SIQTTGTWQSTQQAAPAKATQYQKAPAQPAQQQGPPPWDDPEGHYIVKPDDVIGGRYKIV
RLLGQGTFGKVVEARHIETRRKVAIKVIRAVQKYREASKIEIRVLETLRKHDPRNDNKCI
HLDEYFDFRNHPCLVSELYGMSVFDFLKQNGFQPFPDKHIQDFAKNLHSLKLVHTDLKPE
NILLCSNEARLAGPRVRNARSKSILKNTEIRLIDFGSATFESEYHSSVVSTRHYRAPEII
LGLSWSYPCDMFSIGCILVEFYTGNALFQTHDNLEHLAMMEVVMGKFSQRMIEKGKSKKP
EYFKGNKIDFPNSTVSKASRKYVKSMQSLKQVIDPANRHQQLFLDLCTRLLEHDPDVRIK
VQDALRHPYLTEPIPEPA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagcagccacctcgcccacgccacccacctcccccgccccgcagactccctc
ccgcgcagcccatacccgcacgacgcccagcactcgccgctccctcccccgtccttcctc
cacgcctttccgctgccgccccgggcgtccatctcctccgtcgctgcgcccccggcgagc
gccccgctgcactctgcgccgccctactcgtccgcacagaccctccgtgcctcgctgccg
ctcccccacccgtactacccgctccccctgccacacaccccgtccggccaccgcgtgctc
cgctcccccaacccgccgtgtctctggccgctgccccacccgctgcccgccatcgactcc
ctccggcgcccgtcccgccatcccccgcaccccgcctcccactccggctcgcccagcttg
gaccacccgcgagcctactacgatcccaccgtctccgtcccgctcgcctaccgcgagtcg
tatccgtcccacccgtccacccacccaagttccccctatcttccccctcccaccccgtcc
gcgtacggctaccgcgccccgtccccgttccggatcccgcctccgttgacgttcaggtac
tctcgctcaccgccgcctctcgacaccatgccgccacgcaaaaaggccgagccgtcgacc
gcagacacagtggctgcatccaatgcatcagcgactaccggcgcaccggcctctgccagc
acgagagcaagaagaggtgccaacggcaagggatggacgaccgagcacacgtacgagccc
aacggccagcgcaaggaggtcatcgtcattgacgattctgccagcccaatggtgcagcct
gtgagaaagaggacgcgggcgcaggtcgcggctgagcaagcagcccagcaacagcagtta
catcaggcctatgcgagcacgaacgcgggctactcagatacggtgagcatatcaaatggg
cacggcagcgtggccagcaccgccggtacagcagcgggaggaaccacgaagaagagaaag
ttggaggaggaccagggaaagaaggcaaaagccaaggttgcgagtacggcgacgtcggca
tcaatacagacgaccggcacctggcaatcgacccaacaggctgccccagcaaaggccacc
cagtaccagaaagcccccgcccagccggctcagcagcagggtccaccaccgtgggatgac
ccagaaggccattacattgtcaagcctgacgatgttatcggcggtagatacaaaattgtc
aggttactgggtcaaggaacgtttggtaaggtggttgaagcaagacatattgagacacgg
cgtaaagtcgcgatcaaggttatccgggccgtgcaaaagtaccgtgaggcgagcaaaatt
gagatcagagtgcttgaaacgcttagaaagcatgatccacggaatgacaacaaatgtata
catctcgacgaatactttgacttccggaaccatccgtgtctcgtctcagagttgtacgga
atgagcgtatttgactttttaaagcagaacggtttccaaccatttccggataagcacatt
caagactttgcaaagaacttgcattctctcaagctcgtgcacaccgatctcaagcccgag
aatattcttttatgttcaaatgaggcgagattagcaggccctagagtccgaaatgctcgt
tcaaagtccatcctcaagaacactgaaatccgtcttatcgattttggttctgccactttt
gaatctgaatatcattcctctgtcgtctctactagacactatcgtgcccctgaaatcata
cttggtctttcatggtcttatccttgtgacatgttcagtataggctgtatcctggtagag
ttctacactggaaacgcgctttttcagacgcacgacaatttggaacatttggcgatgatg
gaggttgtgatgggtaagtttagccagaggatgattgagaagggaaagagtaaaaagcca
gagtactttaaaggcaacaagatagattttccaaactctacggtttccaaggcgagcaga
aaatatgtcaagagcatgcaaagcctaaagcaagtgatcgatcctgccaacagacatcaa
cagttgttccttgacctttgtacgagactgctagagcatgatccggacgtccggatcaag
gtgcaagacgctttacgacatccttatctgaccgagcctattccagagcctgcataa

DBGET integrated database retrieval system