KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA6760Help
Entry
CNBA6760          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 4933941
NCBI-ProteinID: XP_777554
UniProt: F5HI86
Position
1
AA seq 111 aa AA seqDB search
MAGDTYTPGDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAAN
VNKGVTWEGQTLFEYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEATK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacacttacactcctggtgacgcttctaagggtgctggtatcttcaagacc
cgatgcgcccaatgtcacacccttggtgctggtgaacctcacaaggttggccctaacctc
cacggtctcattggccgaaagtccggtcaagccgagggtttctcttacactgccgccaac
gtcaacaagggcgttacttgggaaggacaaaccctcttcgagtaccttgaaaaccccaag
aagtacattcctggtaccaagatggcctttgctggtctcaagaaggccaaggacaggaac
gacctcgtcgcccaccttgaggaggctaccaagtaa

DBGET integrated database retrieval system