KEGG   Cryptococcus neoformans B-3501A: CNBA6760Help
Entry
CNBA6760          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CNBA6760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 111 aa AA seqDB search
MAGDTYTPGDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAAN
VNKGVTWEGQTLFEYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEATK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacacttacactcctggtgacgcttctaagggtgctggtatcttcaagacc
cgatgcgcccaatgtcacacccttggtgctggtgaacctcacaaggttggccctaacctc
cacggtctcattggccgaaagtccggtcaagccgagggtttctcttacactgccgccaac
gtcaacaagggcgttacttgggaaggacaaaccctcttcgagtaccttgaaaaccccaag
aagtacattcctggtaccaagatggcctttgctggtctcaagaaggccaaggacaggaac
gacctcgtcgcccaccttgaggaggctaccaagtaa

DBGET integrated database retrieval system