KEGG   Cryptococcus neoformans B-3501A: CNBA7180Help
Entry
CNBA7180          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CNBA7180
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CNBA7180
Peptidases [BR:cnb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNBA7180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1312 aa AA seqDB search
MTRPPSPPSFTGLPLSQLLQYASDDNGAGSHPPKVWFERACYNADKAKLAERKQSKEDMF
VSYSRACQSYINVAMHNDWPETKKKDPQLAARVKDFKPMYDSFVAKAKALKEELRHAEAS
SPAQSKPESSKPSVSRQRSGPEITSIGNIRDRMQALAGHGMEVETIQSKRLSREAPAKAP
KPAALSSVTNSAARSRSGSESRPLSTTTTNGRQLVVTASSKPPPTASQEKSPPSAPVNVQ
ANGSSSRSRRSTLTSEGQGMSVSVGSVAASPAQSPMPTPAAGPYRSPLPSIPSSPQPLPA
SHPPLPSPEPPRPNVPINSSDMESHPEDGLAEFERAFPSLSEFGKQWDGDSLQPDTNSND
MYHAPQYPKPPKQPPISEEDDIPDLPSLPSVPTFKPGLPPPPARPDAYAFSPPATSPSVQ
TRGQTPVPRGPSPPKPDVGSGVGLHRPASTPMPNIAGLDLIDMPDGDVPQGKAMNGGGKM
EALNSPEAVSRPPQYSDATSRPTPTTRHPLPQLPSRPPTSDAVQPTLKPKEKPKFPFSNS
ITPDELREYFLNPSVEMLFLDIRPEDEWKKGYVGREYEKRGARVEIVWLDPTVLLREGMT
ASKLEDALSLSPAVQREAFQNRHKYDLVIVYDTRSPVWPKDGPLNRIWDIFFMGHDEKRL
QRNPVILVGGYEKWREFIKMRAARHAHTAKGKDVREGVNGYAVMRSDVVSPAPSEISVKN
ANREAPVYQASQYAKSIAENFGAGPQSMTGDSYRPSTHSHSQSQLYTPTYRHHHSRTGST
YSSHGAIAAPPQASIHPGPGARRRSDYIEHTGQSYSGSASTSPSIQSTGTTPQPQQQYYA
SPSLPASNSVTPSISSMASPRASIDYPQAHALAKVPVPMPPPAVARPMERHDAYTSTHVH
AQSLVPTSSGYGQLPSQGQVTRSQAMRRMDTVPVGGKDKVGYWRDVVLGITGLKNLGNTC
YMNSTIQCLSATYPFSTFFLDGTFARSINKENPLGTKGELAKAWAELLRVLWSEKYEFLS
PMTFRKQITHFAPQFLGSDQHDSQEFLSFVLDGLHEDLNRVKRKPPPVEMTPEREAMLES
APPEVASEREWAIYRQRNDSLIVDLFQGQYRNRLECLTCHKTSTTYDAFMYMSLPVPSGK
TKVVIQELIDEFVKAEVMEKENAWYCPRCKTNRRASKTLTIARLPPVLLIQLKRFTTRDG
LFWDKSETPVIFPIRGLDLTRYLPGPAGSSIGSGRQVGPDGTFDPRAQVGPFKYDLYGVS
NHMGTLSSGHYTAFVKSKEGWKYCEDSQVMPAQEKDVISRPAYILFYKRVPG
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgactcggccgccgtccccgccatcgttcacagggctcccgctctcgcagctgctgcag
tacgcctcggacgacaacggcgcaggcagccacccgcccaaagtatggttcgaacgcgca
tgctacaacgccgacaaggcaaagttggcagagcgcaaacagagcaaagaggacatgttc
gtcagctacagcagggcgtgccagtcctatatcaacgttgcgatgcacaacgactggcca
gagaccaagaaaaaggatcctcagttggccgccagagtcaaggatttcaagccgatgtac
gattcatttgtcgcaaaggccaaggctttaaaagaggaacttcggcatgcggaggcatct
tcacccgctcagtccaaaccagaatcatccaaaccatcggtatcaagacaacgatctggg
cctgaaataacatcaatcggcaacatcagagatcgaatgcaggcacttgccggacacgga
atggaggttgagactattcagtcgaagcgcttaagtagagaggctcctgccaaagcgcca
aagcctgctgcattgagtagcgtgaccaactctgcggcaaggtctaggagtggcagcgag
tcgcgacctttgtccacaacaacgaccaatgggcggcaactcgtggtcactgcttcatct
aaaccaccaccaactgcgtcacaagagaaatcacctccatctgcacccgtcaacgtacaa
gccaatggatcgtccagcagatcacggcgatccactttgacgagtgaagggcagggcatg
agcgtatctgttgggtctgtggcagcttcaccggcgcaatcaccgatgcccacacctgca
gctggcccatacagatcgcccttaccctccatcccttcctctcctcagcctcttccagca
tctcatccgccattaccctctcccgagccaccacgaccaaatgttcccatcaactcgtcc
gacatggagtctcatcctgaagacggcttggcagagtttgagcgtgctttcccatctctc
tccgaatttgggaaacaatgggatggcgactcgttacagcctgacacgaatagtaatgat
atgtaccacgccccgcagtacccgaaacctccaaagcaaccgcctatctctgaagaagac
gatatcccagaccttccatctttaccttccgttccgacattcaagcccggcctgcctccc
cctcctgctcgaccggacgcatatgcattctcaccaccagccacttccccgtctgttcaa
actcggggacaaactcccgtcccccgcgggccatcacctcctaaacccgatgttggttcg
ggtgtcggtctgcatcgaccggctagtacgcccatgcctaatattgctggtttagatctg
atagatatgcctgatggggatgtacctcaaggaaaagccatgaacggtggtggaaaaatg
gaagctctaaattcccctgaggctgtatctaggcctccccaatattctgacgcaacatcc
cgtcctactccaaccacacggcatcctcttccccaacttccttctcgccctcccacctct
gatgccgtacagcctactctcaaacccaaggagaaaccaaagtttccttttagtaattct
atcactccggatgaacttcgcgaatactttctcaatccttcagtggagatgttgttcttg
gacataaggccggaagacgagtggaagaagggatatgtagggagagagtatgagaagaga
ggtgcgagggtggagattgtgtggctggatccgacagtcttgcttcgtgaaggtatgacc
gcgagcaaattagaagacgcactttccctttcccccgctgttcaacgcgaagcttttcag
aatcgacacaaatacgacctcgtcatagtctacgacactcgttctcccgtatggcccaag
gacggtcctttaaaccgaatttgggatatattctttatgggccacgacgagaagcgtttg
cagagaaatcccgtcattttggtaggaggttatgaaaagtggagagagtttatcaagatg
cgagcggctaggcatgcacatacggcaaaggggaaggatgtgagggagggggtgaatggg
tatgcggtgatgcgatcggatgttgtgtcccctgcgccttccgagattagtgttaagaat
gcgaacagggaagcaccggtctaccaggcatcacagtatgcgaagagtatcgctgaaaac
tttggcgctggaccccaatccatgacgggagactcgtaccgtccctccacacattctcac
tcccaatcgcaactctacacgcccacatacaggcatcatcactccagaacgggctcaact
tactcctcccacggcgctattgccgctcctccacaagcttccattcaccccggaccaggt
gccagacggcgaagcgactacattgaacatacaggtcaatcgtactctggctcagcctcg
acttccccctccatacaatcgactggcaccacacctcaacctcaacagcaatactacgct
tccccatccctccctgcttctaactccgtgacaccgtccatatcatccatggcctctcct
cgggcatcgatcgattaccctcaagcgcacgcattggcaaaggtaccagtcccgatgcct
cccccagccgtggcgagaccgatggaacgacatgatgcgtacaccagcacacatgtgcat
gcgcagagtttggtaccgacttcttccggttatggtcaacttccatcacaagggcaagtg
acgaggagtcaggcgatgaggcgcatggacactgtgcctgttggtgggaaggataaagtg
gggtattggcgggatgtggtgttgggtattaccgggttgaagaaccttggaaatacttgt
tatatgaactcgacaatacagtgtctcagtgcgacatacccattctctacgtttttcctt
gatggaacgtttgcacgttcaataaacaaagaaaatcccttggggacgaaaggcgagttg
gccaaagcctgggcagaattattgagagtattgtggagtgagaaatatgagttcttatca
cctatgactttccggaaacaaatcactcactttgctccccaattcctcggttctgaccaa
catgactctcaagaattcttgtcattcgtccttgacggcttacatgaggaccttaaccga
gtcaagcgcaaacccccccctgtggagatgactcccgaaagagaggcgatgctggagagc
gccccaccagaagtggcttctgagagagaatgggcaatctaccggcagaggaatgatagt
ttgattgtggatctgttccaggggcagtataggaataggttggagtgtttgacctgtcac
aagacatcgacaacttatgatgcgttcatgtacatgtctctgcccgttccatcgggtaaa
acaaaggtggttatacaagaactcattgacgaattcgtcaaggccgaagtgatggaaaag
gagaacgcctggtattgtcctcgctgcaaaaccaaccgtcgtgcttccaagacactaacc
atcgctcgtcttccacctgtactgctcatccaactcaaacgattcacaacgcgagacggt
ctcttctgggacaagtccgagacaccggtcatcttccccatcagaggtttagatcttaca
cggtacttgcctggacctgcaggttcgtcgataggaagtggaaggcaggtggggccggat
ggaacgtttgatccaagggctcaagtggggccgttcaagtatgatttgtatggtgtaagt
aatcatatggggacgctcagttcaggtcattatacggcttttgtgaagagtaaagaagga
tggaagtattgtgaggatagtcaggtgatgcctgcacaggagaaggacgtaatttcccga
ccagcatatatcttgttctataagcgagtacctggatag

DBGET integrated database retrieval system