KEGG   Cryptococcus neoformans B-3501A: CNBB0800Help
Entry
CNBB0800          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNBB0800
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CNBB0800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 435 aa AA seqDB search
MPSTTDPLADSRASPQSPRSIPTANLNNLSLLSESSTGSWERGRMAGNARSPPTNSILAD
SLAAGVAPVAAGVNVVEGGNDLSPSSGAKSLRSGGAYPQPQRPWPADKGLSRPNPATGRV
SFPSVPQYARQAREGYGFRPRSGQTTPTTGAEASLTYPFPSTSSSRVPRPKEDDDDLDHR
PDGKSMDELRGEVREELDKQGLVQAAKGVVEPHMGISGIADEEGLGWPAKSTHLRLHSTP
EEKSANMELLTSALRTVLECIGEDPDREGLQRTPERYAKALLWMTKGYEERLVDVINDAV
FAEDHDEMVIVRDIEVFSLCEHHLVPFTGKISIGYIPSKLVLGLSKLARIAETFSRRLQV
QERLTKQVALAVEEAIRPRGVAVVMEASHMCMSMRGVQKPGATTVTSTMLGCFRQQQKTR
EEFLTLIRTPSAARH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccttccacaactgaccctctcgccgactcccgcgcatcccctcagtctccccgttct
atccccaccgccaacctcaacaatctctctctcctttccgaatcctctactggttcttgg
gaacgcggcaggatggcgggcaacgctcgttcaccgcctacaaattctatccttgccgac
tcgctcgcagctggtgttgctcccgtagcggcgggtgtaaatgtggtcgaaggcggtaac
gacttatccccatctagtggagccaaaagtttgaggtctggcggagcctaccctcaacct
caacgtccttggcccgctgacaagggcctttcccgtcctaaccctgctactggtagggta
tccttcccgtctgttccccagtatgctcgtcaggcgcgtgaaggctacggcttccgcccc
aggtctggtcagactacccctaccaccggtgcggaagctagtttgacttatcctttcccc
agtaccagctcttctagagttccaaggcccaaagaggatgacgatgatcttgatcataga
ccggatgggaagtcaatggacgaattgaggggcgaggtcagggaagaactggataaacag
gggttggtgcaggctgccaaaggggttgttgaacctcacatgggtatctctgggattgct
gatgaagagggtctcggatggcctgccaagtccacacatctccgtctgcactccaccccc
gaagagaagtccgccaacatggagctcctcacctctgctcttcgaaccgtgcttgaatgc
attggtgaagaccctgaccgggaaggattgcaacgtaccccagaaagatatgccaaagct
ttgttgtggatgactaagggttacgaggagaggcttgtagatgtaatcaacgatgcagtc
tttgcggaagaccacgatgagatggttatcgtgagggatattgaggtatttagtctttgc
gagcatcacttggttcctttcactggaaagatttctattggctatatccccagcaagctt
gttttgggtctttccaaactcgctcgtatcgccgaaactttctcccgtcgtcttcaagtt
caagaacgtctcacaaagcaagttgctcttgctgttgaagaggccatccgccctcggggt
gtcgctgttgtgatggaggcttcgcacatgtgcatgtctatgagaggcgtccagaagccc
ggcgcgaccactgtcaccagcaccatgttgggatgtttcaggcagcagcaaaagacgcga
gaggagttcttgaccctcatccgtactcccagcgctgccagacactaa

DBGET integrated database retrieval system