KEGG   Cryptococcus neoformans B-3501A: CNBB2420Help
Entry
CNBB2420          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CNBB2420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 236 aa AA seqDB search
MAWLSSGRTNVELIENMKSSGLIHSSRVAAAMMKVDRKHYVPLRTFAYEDSPQKIGFGAT
ISAPHMHAHACENLLELLPQTQNGGEEPPRILDVGSGSGYLTAVFHYLSPKSLVVGIDHI
QGLVSQSIRNLADDGVKVLDKHNVEGGGVLMLCGDGRKGSKEYAPFTVIHVGAAAPEFPD
ELVDQLAKPGRMFIPVGKGSQDVWQVDKSANGDVTKKKLFGVMYVPLTDADKQWQE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcatggttatcaagtgggcgcaccaatgttgaacttattgagaacatgaaaagctct
ggcttaattcactcttctcgggtggcagctgctatgatgaaggtggatagaaaacactat
gtaccacttcgtacatttgcctatgaggattcccctcagaaaatcggatttggagcaact
atatccgctcctcacatgcatgctcatgcatgtgaaaacctccttgagctcctgcctcag
acccagaatggtggggaagagcctcctcggatcttggatgtgggaagcggatctggttac
ttgacggccgtctttcactatctatcacccaagtctctagttgttggcatagatcatatt
caaggtctggtatctcaatcgatacgcaaccttgccgatgatggagtcaaagtcctcgac
aagcataatgttgaaggcgggggggttctgatgctttgcggtgatgggcgaaaaggatca
aaagaatatgctcccttcacggtcattcacgttggagcagctgctccagaatttcctgac
gagttggtagaccaactagccaagcctgggaggatgtttattcctgttggaaaaggatca
caagatgtgtggcaagtcgacaagtcagctaacggtgacgtgaccaagaagaaactgttt
ggagtcatgtatgttccccttacggatgctgacaagcaatggcaagaatga

DBGET integrated database retrieval system