KEGG   Cryptococcus neoformans B-3501A: CNBB4720Help
Entry
CNBB4720          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cnb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cnb00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cnb00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 455 aa AA seqDB search
MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRTALQPRANIVFRSSFHSSSLLL
AETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDKIDVSVNAPVSGTITELLA
EEESTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEEGNKDEAAPAAGKEKGAGEEA
LAKHEEKAPKLDKAEAEKPAPKKQEKPSPKQEPQPEKAVGSRNETRVKMSRMRQTIAQRL
KASQNAAASLTTFNEIDMSSLMEFRKLYKDGVLKNEGVKLGFMSAFAKASCLALKEIPAA
NASIEGDSIVYRDYVDLSVAVATPKGLVTPIVRNAESMGLVEIEKAIADLGKKARDNKLS
IEDMSGGTFTISNGGVFGSLYGTPIINLPQAAVLGMHTIKEKPVVVNGQIVIRPIMVVAL
TYDHRLLDGREAVTFLVRIKEYIEDSRRMLLPSPI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggacgtcctcccgcgccatcgcttcctcttccactgccgcccttagacgatca
agtcttcggtccatctctcttgccaggaacgtctccaaaactcagatctctcgcactgct
cttcaacctcgggccaacattgttttccgttccagtttccactcttcatctctcctcctc
gcggagaccgtcaaggttccacagatggctgagtccatcacggaaggcactctgaaacaa
tggagcaagcaagtcggtgattttgtcaaacaagacgaggagattgctaccattgagacc
gacaagattgatgtctcagtcaacgctcctgtttccggtactatcactgaactccttgcc
gaggaggaatctactgtcactgttggccaagatcttctgaagattgaaccgggagagggt
ggcgctcagtcctcagagtccaagcctcaagccaagtctgagcctaagaatgctgaagaa
ggcaacaaggacgaagcggcccctgccgctggcaaggagaagggagccggtgaggaggca
ctcgccaagcatgaggaaaaggcgcccaagttggacaaggctgaggctgaaaagcctgct
ccaaagaaacaggagaagccttcccctaagcaggagcctcaacctgagaaggctgttgga
agcaggaatgaaaccagggtcaagatgtcccgaatgcgacaaactattgcccaacgtctc
aaggcgtcccaaaatgcggccgcttcccttactaccttcaacgaaattgacatgtcttcc
cttatggaattccgaaaactttacaaggatggcgtcctgaagaacgagggtgtcaagctt
ggtttcatgtctgcttttgccaaggcctcttgtcttgcccttaaggaaattcccgccgcc
aatgctagcattgaaggcgactccatcgtttacagggactatgttgacttgtctgtcgcc
gttgccactcctaagggtctggtgactcccattgtcaggaacgcggaaagcatgggtctc
gtcgagattgaaaaggcgattgctgatttgggtaagaaggctcgagacaacaagcttagc
atcgaggacatgtccggcggtactttcaccatctccaatggtggcgtcttcggttctctt
tacggtacccccattatcaacttgcctcaagctgccgtgcttggtatgcacactatcaag
gagaaacctgtggtggtgaatggccaaatcgttatccggcctatcatggttgttgctctt
acatatgaccatcgattactcgacggccgggaagccgtcactttcctcgttcgtatcaag
gaatacattgaggactccaggaggatgttgcttccgtcccctatctaa

DBGET integrated database retrieval system