KEGG   Cryptococcus neoformans B-3501A: CNBB4720Help
Entry
CNBB4720          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNBB4720
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNBB4720
  Amino acid metabolism
   00310 Lysine degradation
    CNBB4720
Enzymes [BR:cnb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CNBB4720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 455 aa AA seqDB search
MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRTALQPRANIVFRSSFHSSSLLL
AETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDKIDVSVNAPVSGTITELLA
EEESTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEEGNKDEAAPAAGKEKGAGEEA
LAKHEEKAPKLDKAEAEKPAPKKQEKPSPKQEPQPEKAVGSRNETRVKMSRMRQTIAQRL
KASQNAAASLTTFNEIDMSSLMEFRKLYKDGVLKNEGVKLGFMSAFAKASCLALKEIPAA
NASIEGDSIVYRDYVDLSVAVATPKGLVTPIVRNAESMGLVEIEKAIADLGKKARDNKLS
IEDMSGGTFTISNGGVFGSLYGTPIINLPQAAVLGMHTIKEKPVVVNGQIVIRPIMVVAL
TYDHRLLDGREAVTFLVRIKEYIEDSRRMLLPSPI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggacgtcctcccgcgccatcgcttcctcttccactgccgcccttagacgatca
agtcttcggtccatctctcttgccaggaacgtctccaaaactcagatctctcgcactgct
cttcaacctcgggccaacattgttttccgttccagtttccactcttcatctctcctcctc
gcggagaccgtcaaggttccacagatggctgagtccatcacggaaggcactctgaaacaa
tggagcaagcaagtcggtgattttgtcaaacaagacgaggagattgctaccattgagacc
gacaagattgatgtctcagtcaacgctcctgtttccggtactatcactgaactccttgcc
gaggaggaatctactgtcactgttggccaagatcttctgaagattgaaccgggagagggt
ggcgctcagtcctcagagtccaagcctcaagccaagtctgagcctaagaatgctgaagaa
ggcaacaaggacgaagcggcccctgccgctggcaaggagaagggagccggtgaggaggca
ctcgccaagcatgaggaaaaggcgcccaagttggacaaggctgaggctgaaaagcctgct
ccaaagaaacaggagaagccttcccctaagcaggagcctcaacctgagaaggctgttgga
agcaggaatgaaaccagggtcaagatgtcccgaatgcgacaaactattgcccaacgtctc
aaggcgtcccaaaatgcggccgcttcccttactaccttcaacgaaattgacatgtcttcc
cttatggaattccgaaaactttacaaggatggcgtcctgaagaacgagggtgtcaagctt
ggtttcatgtctgcttttgccaaggcctcttgtcttgcccttaaggaaattcccgccgcc
aatgctagcattgaaggcgactccatcgtttacagggactatgttgacttgtctgtcgcc
gttgccactcctaagggtctggtgactcccattgtcaggaacgcggaaagcatgggtctc
gtcgagattgaaaaggcgattgctgatttgggtaagaaggctcgagacaacaagcttagc
atcgaggacatgtccggcggtactttcaccatctccaatggtggcgtcttcggttctctt
tacggtacccccattatcaacttgcctcaagctgccgtgcttggtatgcacactatcaag
gagaaacctgtggtggtgaatggccaaatcgttatccggcctatcatggttgttgctctt
acatatgaccatcgattactcgacggccgggaagccgtcactttcctcgttcgtatcaag
gaatacattgaggactccaggaggatgttgcttccgtcccctatctaa

DBGET integrated database retrieval system