KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBB4720Help
Entry
CNBB4720          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00020  Citrate cycle (TCA cycle)
cnb00310  Lysine degradation
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01200  Carbon metabolism
Module
cnb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cnb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNBB4720
  Amino acid metabolism
   00310 Lysine degradation
    CNBB4720
Enzymes [BR:cnb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CNBB4720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N HlyD_D23
Motif
Other DBs
NCBI-GeneID: 4934566
NCBI-ProteinID: XP_777242
UniProt: F5HE43
Position
2
AA seq 455 aa AA seqDB search
MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRTALQPRANIVFRSSFHSSSLLL
AETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDKIDVSVNAPVSGTITELLA
EEESTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEEGNKDEAAPAAGKEKGAGEEA
LAKHEEKAPKLDKAEAEKPAPKKQEKPSPKQEPQPEKAVGSRNETRVKMSRMRQTIAQRL
KASQNAAASLTTFNEIDMSSLMEFRKLYKDGVLKNEGVKLGFMSAFAKASCLALKEIPAA
NASIEGDSIVYRDYVDLSVAVATPKGLVTPIVRNAESMGLVEIEKAIADLGKKARDNKLS
IEDMSGGTFTISNGGVFGSLYGTPIINLPQAAVLGMHTIKEKPVVVNGQIVIRPIMVVAL
TYDHRLLDGREAVTFLVRIKEYIEDSRRMLLPSPI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggacgtcctcccgcgccatcgcttcctcttccactgccgcccttagacgatca
agtcttcggtccatctctcttgccaggaacgtctccaaaactcagatctctcgcactgct
cttcaacctcgggccaacattgttttccgttccagtttccactcttcatctctcctcctc
gcggagaccgtcaaggttccacagatggctgagtccatcacggaaggcactctgaaacaa
tggagcaagcaagtcggtgattttgtcaaacaagacgaggagattgctaccattgagacc
gacaagattgatgtctcagtcaacgctcctgtttccggtactatcactgaactccttgcc
gaggaggaatctactgtcactgttggccaagatcttctgaagattgaaccgggagagggt
ggcgctcagtcctcagagtccaagcctcaagccaagtctgagcctaagaatgctgaagaa
ggcaacaaggacgaagcggcccctgccgctggcaaggagaagggagccggtgaggaggca
ctcgccaagcatgaggaaaaggcgcccaagttggacaaggctgaggctgaaaagcctgct
ccaaagaaacaggagaagccttcccctaagcaggagcctcaacctgagaaggctgttgga
agcaggaatgaaaccagggtcaagatgtcccgaatgcgacaaactattgcccaacgtctc
aaggcgtcccaaaatgcggccgcttcccttactaccttcaacgaaattgacatgtcttcc
cttatggaattccgaaaactttacaaggatggcgtcctgaagaacgagggtgtcaagctt
ggtttcatgtctgcttttgccaaggcctcttgtcttgcccttaaggaaattcccgccgcc
aatgctagcattgaaggcgactccatcgtttacagggactatgttgacttgtctgtcgcc
gttgccactcctaagggtctggtgactcccattgtcaggaacgcggaaagcatgggtctc
gtcgagattgaaaaggcgattgctgatttgggtaagaaggctcgagacaacaagcttagc
atcgaggacatgtccggcggtactttcaccatctccaatggtggcgtcttcggttctctt
tacggtacccccattatcaacttgcctcaagctgccgtgcttggtatgcacactatcaag
gagaaacctgtggtggtgaatggccaaatcgttatccggcctatcatggttgttgctctt
acatatgaccatcgattactcgacggccgggaagccgtcactttcctcgttcgtatcaag
gaatacattgaggactccaggaggatgttgcttccgtcccctatctaa

DBGET integrated database retrieval system