KEGG   Cryptococcus neoformans B-3501A: CNBB4850Help
Entry
CNBB4850          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cnb00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 342 aa AA seqDB search
MACNLTTSAIPSLLHSYVPQSLRPFVTLSYPITDPLAHPSAQTLYDKGPRDACFVVFWAL
AFTVLREAAMKGVFSPFMRICLPSPPRVKGQEREYAKARKKREHTVTRFAEQGWSWLYCS
IYWTFGVIVLRQNASPTSPEQLWGTYPVIPLPALTKFYYLSQLGWWFHQLLVINCEKRRK
DHWQMFGHHILTITLIVGSYAMNFTSVGVLIHCLMDFCDILLPLAKMFRYLSFTTLCDFT
FVVFLISWFITRQVGLFLVIRSTYLDLPKFIPFEWTPEQGRFLTYWTHIGFVSMLSILWI
LATAWFYMACIVAIRVVRGMGAQDSRSDDGANRARWSECQRV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcaacctcaccacctccgccatcccgtccctcctccactcctatgtcccacag
tccctgcggccctttgtgaccttgtcgtatcccatcacagacccgctcgcccacccgtcg
gcgcagacactgtacgacaagggcccgcgagatgcctgcttcgtggtcttctgggcgctg
gcattcactgtgctccgggaggcggccatgaagggtgtcttctctccctttatgcgaata
tgtctgccaagcccgccgagggtcaagggacaggagagagaatatgcaaaggccaggaag
aagagggagcataccgtcacgcggtttgcagagcaaggttggagctggctgtattgctct
atatattggacgtttggcgtcattgtcctccgtcaaaatgcctctccaacatctcccgag
cagctctggggcacatacccggtcatccctctcccagcacttaccaagttttactatctc
tcccagctcggttggtggttccaccagctgctcgtgatcaactgcgagaagcgaagaaaa
gaccactggcagatgtttgggcaccacatcttgaccattactttgattgtggggagctat
gccatgaactttacctcggtcggtgtccttatccactgtcttatggacttttgcgacatt
ctcttaccactcgccaaaatgtttcgctatctctccttcaccactctctgcgacttcaca
ttcgtcgtcttcctcatctcatggttcatcactcgacaagtcggtctcttcctcgtcatc
cgcagcacctatctcgacttgcccaaattcatcccctttgaatggactcccgaacaaggc
cgattccttacctactggacacacattggctttgtctccatgctctccatcctctggatc
ctcgcgaccgcgtggttttacatggcttgcattgtcgctatccgcgtggtgcgaggtatg
ggtgctcaagactcgagaagtgatgatggtgcgaacagggcgcgttggagcgagtgccag
agagtgtag

DBGET integrated database retrieval system