KEGG   Cryptococcus neoformans B-3501A: CNBB5140Help
Entry
CNBB5140          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CNBB5140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 139 aa AA seqDB search
MAPKSVASKAPASQASKAPAAASKAPAKAAKTSAAPKDGAKKRSKKRVESYSSYIYKVLK
QVHPDTGISNKAMAILNSFVSDIFERIATEASKLASYNHRSTISSREIQTSVRLILPGEL
SKHAISEGTKAVTKYSSSK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagtctgttgcttccaaggctcctgcttcccaggcctccaaggcccccgct
gccgcgtccaaggctcccgccaaggccgctaagacttctgctgctcccaaggacggtgcc
aagaagaggtccaagaagagggtcgagtcttactcttcttacatctacaaggtcctcaag
caggtccaccccgacactggtatctctaacaaggccatggctatccttaactctttcgtc
tctgacattttcgagcgaattgccactgaggcttccaagcttgcttcttacaaccaccga
tctaccatctcttctcgagagatccagacctctgtccgactcatccttcctggtgaactc
tctaagcacgccatctctgagggtaccaaggctgtcaccaagtactcttcttccaagtaa

DBGET integrated database retrieval system