KEGG   Cryptococcus neoformans B-3501A: CNBC0610Help
Entry
CNBC0610          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CNBC0610
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CNBC0610
Protein kinases [BR:cnb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CNBC0610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 365 aa AA seqDB search
MADFVKLSIFGTVFEVTTRYVDLQPVGMGAFGLVCSAKDQLSGTSVAIKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
IASENTLRFVQSLPKREKVPFSTKFPNADPVSLDLLEKMLVFDPRTRISAAEGLAHEYLA
PYHDPTDEPVAAEVFDWSFNDADLPVDTWKVMMYSEILDFHNLGDISQNEAEGPVTGEVP
AAPAS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggccgattttgtcaagctctccatctttggaaccgtttttgaggttaccacgcgttat
gtcgacctccaacctgtcggtatgggcgctttcggtctcgtctgttccgccaaggatcag
ctctctggaacttctgtggctatcaagaagattatgaagccgttttcaaccccggttctt
tccaagaggacttaccgagagctcaagcttctcaaacacttgagacatgagaacattatc
tctcttagtgacattttcatctctcccctcgaagatatttactttgtcaccgagctgctc
ggtaccgaccttcatcgactccttacctctcgccctcttgagaagcaattcatccaatac
ttcctttaccaaatcctccgtggcctcaagtatgtccactctgccggtgtagtccatcga
gacttgaagccttcaaacattctcgtcaacgagaactgtgacttaaaaatttgcgatttt
ggccttgcgaggatccaagaccctcagatgactggttatgtttctacgaggtactatcga
gcacccgagatcatgttgacatggcaaaagtatgatgtcgcggtcgacatttggagtacc
ggctgtatctttgcggagatgctggagggcaagccattattccccggaaaggaccacgtg
aaccaattctcaatcatcaccgaattgctcggtaccccgccggacgatgtcattcaaact
atcgcctctgaaaacactctccgcttcgtccagagtctgcccaagcgcgaaaaggtccca
ttttccaccaagttccccaatgccgaccctgtttctcttgatttgttagagaagatgctc
gtgtttgaccctcgtacccgtatatccgccgcggaaggtcttgcgcacgagtaccttgca
ccttaccatgatcctaccgatgagcctgttgccgcagaggtgtttgattggagttttaac
gatgccgatttgccggtggatacttggaaggtgatgatgtacagcgaaattcttgacttc
cacaacctcggggacatttcccagaacgaagcagagggacccgttacaggcgaagtcccc
gctgctcctgccagctaa

DBGET integrated database retrieval system