KEGG   Cryptococcus neoformans B-3501A: CNBC2360Help
Entry
CNBC2360          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CNBC2360
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CNBC2360
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CNBC2360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 604 aa AA seqDB search
MIALTDEIYFLWVKTLKQLVSITLDRQVTDITPSDPDMLWIRQLWPLGTKAINREKAEAL
CAQIGLQIKADGMLDITVFHDLIKASQTRPDINQVYRDLTLSGLLDKGRVVSFLTHIQRI
PSSSVENVFNRYKSGDLWTIDSLTSFLSSSDNTPNQPQDMTHPLQHYFISSSHNTYLVGE
QWKGESTVEGYIRVLLAGCRCVEMDVQSGDVEPVVYHRKTLTSSVPVRDICRAIKQYGFV
TSPYPIIISTEIHCASEQQNRLAIILKEVFGDMLVSAPLVEEFSELPSPEDLKGKILFKA
KPPKPELNSPKLEANLFYQESPSSTDSDTSFVRLARRLSIQSKTERPDIFSPQLSELLVY
THGVKYQGFSKLNEYLPSHQFSVSERTAAKILKVNKVDWIKHNFKHISRVYPRGTRLGST
NFNPVDSWSAGCQIVALNWQTLDESILLNHAMFHDSNGYILKPLSLREKVVEVPEKYLLT
VRIISGQRTPLCADLYVEAILNGKISKRTRALSQVTLNPLWDETLTFEITSTPSLLMLNF
LHLEVRNKALQAQWMRPVSLAPRGYHHLPLYDSLLSRFVFATLFVKITVEKLQDVVENEK
SNSI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccttaccgacgagatatatttcctttgggtcaagacgttgaagcaactggta
tctatcactttggatcgccaggttaccgacatcacgccgtctgacccagatatgctctgg
attagacagttatggcctctaggtaccaaagctattaatcgtgaaaaagccgaggcccta
tgcgctcagatcggattgcaaattaaagccgatggcatgctagacatcacagtctttcat
gaccttattaaagctagccagactcgacctgacatcaatcaggtttatcgcgacctcact
ctgagcggtcttctcgataagggacgcgttgtctcttttcttacacatatacagcgtatt
ccatcttcctctgtcgagaatgtgttcaacagatataagtctggagacttgtggaccata
gactctctgacttccttcttatcctcgtctgacaacactcctaatcaaccccaggatatg
acacatcctcttcaacattatttcatttcgagttcccacaatacgtatcttgtgggagag
caatggaaaggtgagagcaccgtggagggttacatccgtgtgttgttagcaggttgtcga
tgtgtagagatggatgtgcaatctggtgatgttgaacctgtcgtgtaccatcgcaaaact
ttgacatcaagtgtcccagtccgagacatctgccgtgccattaagcagtacggctttgta
acatcgccttatcctatcattatctccactgagatccactgcgcctcagagcagcaaaac
cgattggcaatcatattaaaggaagtttttggtgatatgctggtttccgctcctctggtc
gaggaattttcggagttacctagtcctgaagacctgaagggcaaaatccttttcaaggct
aaacctcccaaacccgaactgaattcaccaaaactcgaagccaaccttttctatcaagaa
tcaccgtcttctactgattccgatactagcttcgttcgtcttgctcgccgcctttcaata
caatccaaaactgaacgtccggatatcttctccccccagctctcagaacttctcgtctat
acccatggtgtaaagtaccaaggcttttctaagctcaacgaatatctacctagtcaccag
ttttcagtctctgagcgaacagctgccaagatcttgaaagtaaacaaggtagactggata
aagcacaatttcaaacatatctcaagggtttatccacggggtaccagacttggttcgaca
aattttaatcctgtcgattcttggtctgcaggctgtcaaattgtggccttaaattggcaa
accttggatgaatcaatattgctgaatcacgccatgtttcacgacagtaatgggtacatc
cttaaaccgctttctctacgtgagaaggtcgttgaggtgcctgaaaaataccttcttacg
gtacgaatcatctctgggcaacgcacaccactttgtgccgatctttatgtcgaagcaatc
cttaacgggaaaatctcaaagcgcactcgcgcacttagtcaagtcactctcaacccttta
tgggatgaaactttgacatttgaaatcaccagcacaccaagtttattgatgctcaacttt
ctgcatttagaagtcagaaataaagctttgcaagcgcagtggatgaggccagtcagtcta
gcaccccgaggctatcaccacttgccattgtacgatagccttttgtcacgattcgtcttc
gcgaccttatttgtgaaaataacggtagagaaattgcaagatgtagtcgaaaacgagaaa
tcaaattcgatttaa

DBGET integrated database retrieval system