KEGG   Cryptococcus neoformans B-3501A: CNBC3280Help
Entry
CNBC3280          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CNBC3280
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CNBC3280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1045 aa AA seqDB search
MTIGTIKPRRSLGAIIDSIPSQQEYVPDSCSENSGSDSERDAPIPTLKPIPLTPLPPRSA
RLISELGADPIKIGKKNEREEARAVPGDGKIDTKVHGAVDTLLAPVLYFAVQWRKPQFKK
HKTWDGDANIKVEGNRIVMLDEDGNQMAATNVGDKVIKPEAEFKIGGYEIMVDHVLQQDQ
FKASTSILNRPKVIPTIKSTGYRPASFTKPFRPPIQKANLTPAKPSTMEIVNNEHHQSPI
SSSSKRSIPTPAAAQRAVAASSFYTRQSPKPFNERIVLGEKSNKERLQWGGALFNPHAEG
AVVMPRPGEKLAKLKGTTIVDVVLDPVLGNLLRDHQKEGVKFMYSCVMGMTGAEGEGCIL
ADEMGLGKTLQTIALIYTMLKQSPFANQTSIIGKAIIVCPVTLVDNWRKEFKKWVDRRVN
VLVADGTDYRVSSFLRKVVKELASCIPPIDLIVCDEGHRLKSKDNKTIKMFDMLKTQRRI
RTPVQNDLGEYWAMVNFACPGVLGKYSAFAKHYEKPILKSRTPNCSAKDVELGRERANDL
AKLSKEFVLRRTAAVLENYLPPKYEYVIFIAPSLLQLSVLSNLLDPNIVGSFIRGYGAQS
LALIDLMRKISNSPMLLKRRDDELARANDDLGSATSAAISAIPSDANINDVTTSGKMLML
DKMLHSIYQCTEEKVVVVSNWTSTLDLIQGLCKLKRYNYLRLDGSTPPKQRQELVDRFNK
DKGRQESFVFLLSAKAGGVGLNLIGGSRLILFDSDWNPSTDLQAMARIHRDGQKRPVYIY
RFLTTNAIDEKIYQRQITKTGLSDQMMDQTRTEKQTSKDSFSAAELRDIFTLNVRTDGCQ
THDLLGCQCTRKPVGETRDIAEGEHNSKVLPDNASEESDSDENDHPTFVSANKYDPEPTP
KMRRKAIQEQKNKLAALKHWAHFDPFEPASFRGIQDSLLYNVLFDSWETDSAPLSQNIKT
YGSLAFESPHERHEDDLDSDEEVLVPKKRKSGIVRSGVMLKKARAADEENTGFSQRRHNL
RSIAESGGTGRVTFVFEKISKSTIA
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcggaacgatcaagcccaggcgcagtctcggtgccatcatagactctattcct
agccaacaggaatatgttccagattcttgctcggaaaactcaggctccgattcagaacga
gatgctcccattccaactctcaaacccataccactcacgcctttacctcccagatcagca
cgcttgattagcgaactaggggccgaccccataaaaatagggaagaagaacgaaagagag
gaggctagagctgtacctggtgacggcaaaatagatacgaaggtccatggggctgtcgac
actttattagcgccggtattgtattttgccgtgcagtggaggaaaccccaatttaagaag
cataaaacttgggatggggatgccaacatcaaggtagaaggtaacaggattgtaatgctt
gacgaggatggaaatcaaatggccgctaccaatgttggggataaggtgatcaagccagaa
gccgaatttaagatcggtggatatgagatcatggtagatcatgtattgcaacaggaccaa
ttcaaagctagtaccagtattctcaacaggcctaaagttatcccaacaatcaaaagcacc
ggctaccgacctgcatcattcacaaagccctttagacctcccatacagaaagcaaatttg
accccagcaaagccatcaactatggaaattgtcaacaatgaacaccaccagtcacccatt
tcctcatcttcaaagcgctccatcccaacacccgcagccgcccaacgagcagttgctgct
tcatcattttatacgagacaatcacctaaaccattcaatgaaaggattgtattgggagag
aagagcaacaaggagaggctacaatgggggggagcgttattcaaccctcatgctgaaggt
gcagtggtgatgcccaggcctggggaaaagctggctaaattgaaaggcacaaccatcgtg
gatgtggtgcttgaccccgtcttggggaacttattgcgggaccatcagaaagaaggtgtc
aaatttatgtactcgtgtgtcatggggatgaccggtgcggaaggcgaaggatgcatcctt
gcggatgagatgggtttgggcaagacgcttcaaacaatagcactcatttacaccatgctg
aagcagtctccctttgccaatcaaacatccattatcggcaaagcgatcattgtgtgtccg
gtaacgttggtggacaattggcgcaaagagttcaagaaatgggtggataggcgagtgaac
gttctggtggccgatggtacagattatagggtatcgtcttttcttcgcaaagtcgtcaaa
gaacttgcatcgtgcattccgccaattgaccttatcgtctgtgacgaaggacatcgcctg
aaatccaaagacaataaaacgataaaaatgttcgatatgctcaaaacccaacgccgtatt
aggacgccagtacagaacgatctaggtgaatattgggcgatggtcaattttgcttgtccg
ggtgtgttgggaaaatactcggctttcgcaaagcattatgaaaagccaatattaaaaagc
agaacacctaactgttcagcgaaagatgtagagctaggcagggaaagagcaaatgattta
gccaagttgtccaaggagtttgtcctgcgaaggacggctgcagtgcttgaaaattatttg
cctcccaagtacgagtacgtaatttttatcgccccatcccttcttcagctttcggtcctt
tcaaacctcctcgaccctaatatcgtcggaagcttcatccgaggctatggtgcgcagtca
ttagctctaattgatctcatgaggaaaatttccaattctcctatgcttttaaaacgaaga
gacgacgaattagcacgagcaaatgatgatttaggctcagccacctcagcagcaatctct
gctatccctagcgatgccaacatcaacgatgtgactacgtctggcaagatgctcatgctt
gacaaaatgctccattccatctaccaatgcactgaagaaaaagttgttgttgtgtctaac
tggacttctacacttgacttgatccaaggattatgtaaactgaagaggtacaattatctc
agacttgatggtagtactccgccgaagcagagacaagagctagttgataggttcaacaaa
gacaagggaagacaagaaagttttgtttttctgcttagtgccaaagctggcggagtggga
ctcaacctgattggtggatcgaggttgattttgttcgacagcgattggaacccctccacc
gacctccaagctatggcccggatacatcgcgacgggcaaaagcgcccagtctatatctat
cgctttctcactactaacgccatcgatgagaaaatctatcaacgtcaaattactaagacg
gggctatcagaccagatgatggatcaaacgcgtacagagaaacagacgagcaaagattct
ttctcggcagcagaattgagggacatattcaccctgaatgtacgaacggacggttgtcaa
acacatgatttgttgggttgtcagtgcacgagaaaacctgtaggcgaaacgagggacatt
gcggaaggggagcataattcaaaggtcctgccagacaatgcgtctgaggaaagtgatagt
gacgaaaacgatcatcccacttttgtcagtgccaataaatatgatcccgaacccactccc
aaaatgcgtcgcaaggccattcaagagcaaaaaaacaaactcgccgcgctgaagcactgg
gcacatttcgatccttttgaacctgcatcattccgtggcatacaagactctcttctgtat
aacgtactgttcgattcgtgggagactgatagtgcccctttatcccaaaacatcaagaca
tatggctctctggccttcgagagcccccatgaaaggcatgaggatgatcttgactcagat
gaagaagttttggtacccaaaaaacgcaaatctgggatagtaagaagtggagtcatgctg
aagaaagcgagggcagcggacgaggagaatacggggttcagccaaagaaggcataatctg
agaagcatcgcggaaagtggaggaactgggagagtgacatttgtgtttgagaagatatca
aaaagtaccatagcctaa

DBGET integrated database retrieval system