KEGG   Cryptococcus neoformans B-3501A: CNBC3510Help
Entry
CNBC3510          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CNBC3510
   00052 Galactose metabolism
    CNBC3510
   00500 Starch and sucrose metabolism
    CNBC3510
   00520 Amino sugar and nucleotide sugar metabolism
    CNBC3510
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CNBC3510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MATLEPKQDPQASARQRGHSAMDFKSATTGVAAKTMRNELNRMVANEQDPAKKKMFEAEM
QSFFILFNRFLTERAKGEKLDWDKINPPKPEQVRPYEVLPNVDPSILNKLAVLKLNGGLG
TTMGCVGPKSIIEVRDNMTFLDLSVRQIEHLNEKYNVNVPFILMNSFNTDEDTARIIQKY
QNHNINILTFNQSRYPRVDKESLLPCPRESSSDKSNWYPPGHGDIFDALTNSGLLDKLIA
AGKEYIFISNVDNLGAVVDLNIFQTMIDAQAEYVMEVTDKTKADVKGGTIIDYDGKPRLL
EVAQVPKDHLDEFCSTRKFKIFNTNNIWCNLRAIKRIMDEDALNLEIIVNNKVTDDGLAV
IQLETAIGAAIKHFDSAIGINVPRSRFLPVKSCSDLLLIKSKLYNLEHGVLTMDRSREFG
GTPVVKLGGEFKKVANFEKRFKSIPNITELDHLTVSGDVWFGKSVRLAGTCIIVATEGNK
IMIPDGTNLENKLITGNLSIIDH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctactctcgaacccaagcaggacccccaggcctccgccaggcagaggggccactca
gcaatggactttaaatctgccaccactggtgtcgctgccaagaccatgcgaaacgagctc
aacagaatggtcgcaaacgagcaagaccctgctaagaagaaaatgtttgaagctgagatg
cagtccttcttcatcctcttcaatcgtttcctcactgagcgcgctaagggcgaaaagctc
gactgggacaagatcaaccctcccaagcctgagcaggtccgcccttacgaagtccttccc
aatgttgacccttcaatcctcaacaagcttgctgttctcaagctcaacggtggtctcggc
actactatgggctgtgtcggccccaagtcaattattgaagtcagggataacatgactttc
ctcgacctttctgttcgacaaattgagcacttgaacgaaaagtacaatgtgaatgtgccc
ttcatcctcatgaactctttcaacaccgatgaggacacagctaggatcatccaaaagtac
cagaaccacaacatcaatatcctcactttcaaccaatctcgatacccccgtgttgacaag
gaatctttgctcccttgtcctcgagaatcttcaagtgataagagcaactggtaccctccc
ggacacggtgacatctttgatgctttgaccaactcaggccttcttgacaagctcatcgct
gcaggcaaggagtacatcttcatctccaacgtcgacaatcttggtgctgtcgtcgatctc
aacatcttccagaccatgattgacgctcaggccgagtatgtcatggaagtcactgacaag
accaaggccgacgtcaaaggtggtaccatcattgactacgatggcaagcctaggttgctc
gaggttgctcaagttcccaaggatcaccttgatgaattctgcagcactcgaaaattcaag
attttcaacaccaacaacatttggtgtaacttgcgagccatcaagaggatcatggacgag
gatgcgctcaacctggaaatcattgtcaacaacaaggttaccgacgatggtctagccgtt
atccaactcgaaactgccatcggtgctgctatcaagcacttcgactctgccatcggcatc
aacgttcctcgatcacgatttttgcctgtaaagtcttgctctgatcttcttctcatcaag
tccaagctctacaatcttgagcacggtgttttgaccatggacaggtcccgagaatttgga
ggcacccctgttgtcaagcttggtggcgagttcaagaaggttgccaactttgagaagcga
ttcaagtctatccccaacatcaccgagctcgaccatcttactgtttctggcgatgtctgg
ttcggtaagagcgtgaggcttgctggtacttgtatcattgtcgccactgagggcaacaag
atcatgatccccgacggtaccaacctcgagaacaagttgattactggtaacctttcaatc
attgaccattaa

DBGET integrated database retrieval system