KEGG   Cryptococcus neoformans B-3501A: CNBC4010Help
Entry
CNBC4010          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNBC4010
Translation factors [BR:cnb03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CNBC4010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 299 aa AA seqDB search
MTSTAIPPAAVAANNNTLNSALAAEQISSPASPVDKPVDEKKQLEEGEIEENPSEGDSQT
KTIFDDASKFNVKHPLFSTWTLYFDSPQSKSLPKTPQTTPAMPQGSHGWMADIRKVVSFD
SVEEFWGLYNNIIPPSQLPGKANYYLFKNGIIPAWEDPQNKNGGKWSIQVPKNSESKSSI
DRMWLYTMLAAIGETFETASTDSENAPSPTQSDLITGVIVSPRPAFYRISIWTREASDVN
VPDTDAIKARLLNIGKHFKTSVLGYELEQKLTEGGFQTELTFDAHKDSEKKVNKNKFTV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaacagccataccccctgcagcggttgcggccaacaacaacactctcaatagc
gccctcgccgctgaacaaatttcaagtcccgcttcaccagtcgacaagcccgtggatgaa
aagaaacagcttgaagaaggcgagattgaagagaatccttcagaaggcgactcccaaaca
aagaccatttttgatgatgccagtaaattcaatgttaagcacccattgttttccacttgg
actctttacttcgattcccctcaatcaaagtctctccctaaaacccctcagactaccccc
gctatgccccagggatcccatggctggatggcggatatccgaaaggtcgtgtcgttcgac
agtgtggaagagttctggggtctctataacaacatcattcctccctcccagctccctggt
aaagccaactattatcttttcaaaaatggcattattccggcctgggaagaccctcaaaac
aagaatggtggaaaatggtctattcaagtacccaagaacagcgaaagcaaaagttccatt
gacagaatgtggctctatacgatgcttgctgcgattggcgaaactttcgagacagcctcc
accgactctgagaatgccccttcccctacccaatcagatctcatcaccggcgtgatcgtc
tctcctcgtcccgctttctatcgaatttccatttggactcgcgaggccagcgatgttaac
gttcccgacactgatgcgatcaaggctcgtctgctcaacatcggcaaacacttcaagaca
agtgtcttagggtacgaacttgagcagaagctcacagaggggggcttccaaacagagctc
actttcgatgctcacaaagattctgaaaagaaagtgaacaagaacaaattcactgtgtaa

DBGET integrated database retrieval system