KEGG   Cryptococcus neoformans B-3501A: CNBC4890Help
Entry
CNBC4890          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cnb  Cryptococcus neoformans B-3501A
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 462 aa AA seqDB search
MHPQNSSTPSTNSPSTFSLPKSSISRKKPPGLDISKSILRPTRTAPVLPANGSSPSNFVS
EADRLRDDIANLQLSSRSTGSNHSPEALDSPRAFQSDSSVASGLAKKEKSRDGKERGDKE
KRKKKHKDKDGEDLVKDEDLEILHDLGAGNGGTVTKVWNKKRKCVMARKLILVDAKPSIR
KQILRELQIMNDCDSPYIVGYYGCFPVDVHVGIVMEFMDAGSLDYIYRHHGAIDIDIVGK
VAQAVLEGLIYLYDKHRIIHRDIKPSNVLANTRGEIKICDFGVSGELINSIANTFVGTST
YMSPERIQGAPYTIKSDIWSLGISLIELAVGRFPFSDSPDSEELSPSVSDFDPDPTLPRS
VRRPKIESNSRHNGVSQSGGPHAMSILDLLQHIVNEPAPRLASRRRRFPQEAVAFVEGCL
IKDPDQRRSPKELLSSSWITSLKTTKEDLQTWARSMVGPREE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcacccacaaaattcctcgactccttcaaccaactccccttccaccttctctcttccc
aaatcatccatctcacggaagaaacctccaggactcgacatctccaaatcgatccttcgt
cccacacgtacagcacccgttttgcccgcaaatggaagctcccctagcaactttgtgtca
gaagcagacaggctgagagatgacattgccaacctccagttgtcaagtcgatcaacaggc
tcgaatcactccccggaagcacttgactcccctagggcattccaaagcgacagttcggtt
gcgtcgggtcttgcaaagaaggagaagagcagggacggtaaagaacggggagataaggag
aagaggaagaagaaacacaaggacaaggatggagaagacttggtcaaggatgaagaccta
gaaatactgcacgatttaggagcgggcaacggagggacagtgaccaaagtgtggaacaag
aagaggaaatgcgttatggctcgaaagctcatcctagtagacgccaaaccgtccataaga
aagcagatccttcgagagttacaaatcatgaatgactgtgattctccatacatcgtcgga
tactatggatgttttcccgtcgacgtccatgtaggtatcgtcatggaattcatggatgct
ggatctctggactacatctataggcatcacggcgccattgacattgacatcgttggtaaa
gtcgctcaagcagtgctggagggtctgatttacctttatgataaacaccgtatcatacat
cgagatatcaagccgtccaatgtattagccaacactcgaggggagataaagatatgtgat
tttggagtctctggcgagttgattaactcgatcgccaatacctttgtgggcaccagcaca
tatatgagcccggagcggattcagggagcgccgtacacgatcaaatcagacatctggtct
ctcggtatctcccttatcgagttggctgttggccgtttcccattctccgattcacccgac
tcggaagaactctcacctagcgtttccgactttgatcctgatcctacacttcctcggtcc
gttcgacgccctaaaattgaatcaaacagcagacataacggcgtcagtcagagtggtgga
ccgcacgccatgtctattcttgacctgttgcaacatatcgtcaatgagccagccccaagg
ttggcaagcagacggaggagattccctcaggaggcggttgcatttgtggagggctgcttg
atcaaggatcccgatcaacgaaggagtcctaaagagctgctgtcttcttcgtggataacc
agcctcaaaaccaccaaagaggaccttcaaacctgggctcgatccatggtcggcccccgc
gaggaataa

DBGET integrated database retrieval system